KEGG   Acidiphilium multivorum: ACMV_06450Help
Entry
ACMV_06450        CDS       T01446                                 

Gene name
bcsZ
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amv  Acidiphilium multivorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACMV_06450 (bcsZ)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ACMV_06450 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(733328..734458)
Genome map
AA seq 376 aa AA seqDB search
MTDMARRNFLGLLGAAALTGGPVMMARELWQSSWRGYRHGFIDGQGRVIDYSANKGFSTS
EGQSYGMFLSLVAGDRATFRRILNWTNTNMAGGRLGEVLAAWKWGLHGGKWGVIGANSAA
DADAWMAYSLLEAARIWKDHNLGAEGHKLATRIADDESVAINGFGRVLIPGASDFPDTPP
VIVDPSYTPLFLARGIARATNLPKWQAIAATLPRLMTTICRNGFAPDWAWAPQAPASPPA
GLPETGTGSFDAIRCYLWAGLTAPETEGSATVLASLKGMARYLATHRAPPQSVDLASQAT
HGTGGIGFSAALLPYLAALGRHRLLHQQLGRVLAQRETSGLFGQPADYYSENLILFGLGG
LSGSIRFDKQGGLITS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatggcgagacgcaattttctcggtcttctcggcgcggccgcgctcacgggc
ggcccggtgatgatggcgcgggagctgtggcaatcgtcctggcgcggctaccggcacgga
ttcatcgacggccaggggcgggtcatcgactattccgccaacaagggattcagcacttcg
gaggggcagtcctatggcatgttcctcagtctcgtcgccggcgaccgcgcgacgttccgc
cgcatcctgaactggacgaacacgaacatggcgggcgggcgcctcggggaagtgctcgcg
gcgtggaaatgggggctgcacggcggcaaatggggggtgatcggcgccaactcggcggcg
gacgcggatgcgtggatggcctattcgctgctcgaggccgcccggatctggaaggatcac
aatctcggcgccgaggggcacaagctggcgacgcgcatcgccgatgacgagagcgtggcg
atcaacggatttggccgggtcctgatacccggcgcctccgattttccggacacgccgccc
gtcatcgtcgatccgagttatacgccgctgtttctggcccgcggcatcgcgcgcgcgacc
aacctgccgaaatggcaggcgatcgcggccacgctgccacggctgatgacgacgatctgc
cgcaacggattcgcccccgactgggcctgggcgccgcaagcccccgcctcgccgccggcg
ggcctgccggagaccggcaccggatcgttcgatgcgatccggtgctatctctgggcgggc
ctgaccgcgccggaaacggaggggagcgcgaccgttctcgcctcgctgaagggcatggcc
cgatatctggccacccaccgcgcgccgccgcagagcgtcgatctcgcgagccaggcgacg
cacgggacgggcgggatcgggttttccgcggcgctgctgccctacctcgcggcactcggg
cgccaccggctgctccaccagcagctcggccgcgtgctggcccagcgggagaccagcggc
ctgttcggccagcccgccgactattactcggaaaacctgatcctgttcggacttggcgga
ctttcgggaagcatccgcttcgacaagcaaggaggtctgatcacgtcatga

DBGET integrated database retrieval system