KEGG   Acidiphilium multivorum: ACMV_06450Help
Entry
ACMV_06450        CDS       T01446                                 

Gene name
bcsZ
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amv  Acidiphilium multivorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(733328..734458)
Genome map
AA seq 376 aa AA seqDB search
MTDMARRNFLGLLGAAALTGGPVMMARELWQSSWRGYRHGFIDGQGRVIDYSANKGFSTS
EGQSYGMFLSLVAGDRATFRRILNWTNTNMAGGRLGEVLAAWKWGLHGGKWGVIGANSAA
DADAWMAYSLLEAARIWKDHNLGAEGHKLATRIADDESVAINGFGRVLIPGASDFPDTPP
VIVDPSYTPLFLARGIARATNLPKWQAIAATLPRLMTTICRNGFAPDWAWAPQAPASPPA
GLPETGTGSFDAIRCYLWAGLTAPETEGSATVLASLKGMARYLATHRAPPQSVDLASQAT
HGTGGIGFSAALLPYLAALGRHRLLHQQLGRVLAQRETSGLFGQPADYYSENLILFGLGG
LSGSIRFDKQGGLITS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatggcgagacgcaattttctcggtcttctcggcgcggccgcgctcacgggc
ggcccggtgatgatggcgcgggagctgtggcaatcgtcctggcgcggctaccggcacgga
ttcatcgacggccaggggcgggtcatcgactattccgccaacaagggattcagcacttcg
gaggggcagtcctatggcatgttcctcagtctcgtcgccggcgaccgcgcgacgttccgc
cgcatcctgaactggacgaacacgaacatggcgggcgggcgcctcggggaagtgctcgcg
gcgtggaaatgggggctgcacggcggcaaatggggggtgatcggcgccaactcggcggcg
gacgcggatgcgtggatggcctattcgctgctcgaggccgcccggatctggaaggatcac
aatctcggcgccgaggggcacaagctggcgacgcgcatcgccgatgacgagagcgtggcg
atcaacggatttggccgggtcctgatacccggcgcctccgattttccggacacgccgccc
gtcatcgtcgatccgagttatacgccgctgtttctggcccgcggcatcgcgcgcgcgacc
aacctgccgaaatggcaggcgatcgcggccacgctgccacggctgatgacgacgatctgc
cgcaacggattcgcccccgactgggcctgggcgccgcaagcccccgcctcgccgccggcg
ggcctgccggagaccggcaccggatcgttcgatgcgatccggtgctatctctgggcgggc
ctgaccgcgccggaaacggaggggagcgcgaccgttctcgcctcgctgaagggcatggcc
cgatatctggccacccaccgcgcgccgccgcagagcgtcgatctcgcgagccaggcgacg
cacgggacgggcgggatcgggttttccgcggcgctgctgccctacctcgcggcactcggg
cgccaccggctgctccaccagcagctcggccgcgtgctggcccagcgggagaccagcggc
ctgttcggccagcccgccgactattactcggaaaacctgatcctgttcggacttggcgga
ctttcgggaagcatccgcttcgacaagcaaggaggtctgatcacgtcatga

DBGET integrated database retrieval system