KEGG   Acidiphilium multivorum: ACMV_06500Help
Entry
ACMV_06500        CDS       T01446                                 

Gene name
fixK
Definition
(GenBank) nitrogen fixation regulation protein FixK
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(739913..740620)
Genome map
AA seq 235 aa AA seqDB search
MLHVAAEPSRSTIANWSAAGEPGFRAGALEAGASLFIEGETVDKIYDLVSGIVRLSKMLP
DGRRQILGFLFPGEIFTPSGFAISHGGCATCSADAVTAVEVVTHRLSSFDGLLASRPELT
RSLLATAAKSLFMAQQQMLLLGRMSATERLVWFLLRMAEQQDVEAGEPIRLPMSRVDIAD
YLGLTMETVSRVFRWLRERNIIALKGATEIRIVDPGRARQIADCACSATMPRCRQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatgtcgctgccgagccgtctcggtccacgattgccaactggagtgccgccggt
gagccgggctttcgcgcaggtgcgctggaggccggcgcctcgctgttcatcgaaggcgaa
acggtggacaagatctatgatctcgtgtccggcatcgtccggctgtcgaagatgctgccc
gacgggcgccggcagatcctgggcttcctgtttccgggcgaaatctttacgccgtccggc
ttcgccatcagccatggcggctgcgcgacatgctccgcggatgccgtgaccgcggtcgag
gtcgtgacgcatcggctcagcagtttcgatgggctgctggccagccggccggaactgacg
cgcagcctgctggccacagccgcgaagagccttttcatggcgcagcagcagatgctcctg
ctcggccggatgagcgcgaccgaacgcctggtctggttcctgctgcggatggccgaacag
caggatgtcgaagccggggaaccgatccgcctgccgatgtcccgtgtggatatcgcggat
tacctcgggctgacgatggaaaccgtctcccgcgtcttccgctggctgcgcgagcgcaac
atcatcgccctcaagggggcgacggaaatccggatcgtcgatccgggacgggcgcgccag
atcgccgattgcgcctgcagcgcgacaatgccgcgctgcaggcaatag

DBGET integrated database retrieval system