KEGG   Acidiphilium multivorum: ACMV_06590Help
Entry
ACMV_06590        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K17865  
3-hydroxybutyryl-CoA dehydratase [EC:4.2.1.55]
Organism
amv  Acidiphilium multivorum
Pathway
Glyoxylate and dicarboxylate metabolism
Butanoate metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_06590
   00650 Butanoate metabolism
    ACMV_06590
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.55  3-hydroxybutyryl-CoA dehydratase
     ACMV_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(748972..749472)
Genome map
AA seq 166 aa AA seqDB search
MCAAIRSTATGVPMPSCVPFDQLEPGQTASLGKTITEADILLFSAVSMDTNPVHLNQELA
DETLFKGRVAHGMLCGSLISAVLGTVLPGLGTIYLTQSMRFRAPVRIGDTVTAEVEVASL
DHEKKRATMRTRCFVRGKVVIEGEAVVIPPTEAVVAVAQNEKRAAE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgccgcgatacgttccaccgcgacgggagttcccatgcccagctgcgtacccttc
gaccagctcgaacccggccagaccgcctcgctcggcaagaccatcaccgaggccgacatc
ctgctgttttccgccgtgtcgatggacacgaatccggttcacctgaaccaggagctcgcc
gacgagacgctgttcaagggacgggtcgcgcacgggatgctgtgcggcagcctgatttcg
gcggtgctcggcaccgtgctgccgggattggggacgatctatctcacgcagtcgatgcgg
ttccgcgcgccggtgcgcatcggcgacacggtgacggcagaggtcgaggttgcctcgctc
gatcacgagaaaaagcgggcgaccatgcgcacgcgctgcttcgtgcgcggcaaggtggtg
atcgagggcgaggcggtcgtgattccgccgaccgaggccgtcgtcgccgtggcgcagaac
gagaagcgcgccgccgaatga

DBGET integrated database retrieval system