KEGG   Acidiphilium multivorum: ACMV_06780Help
Entry
ACMV_06780        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K12140  
hydrogenase-4 component E [EC:1.-.-.-]
Organism
amv  Acidiphilium multivorum
Brite
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     ACMV_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
770471..771151
Genome map
AA seq 226 aa AA seqDB search
MHGFHATPVEASLFGVLAIASLLLAFVMLGSRWLRHYLIAFAAESWAIALLSAAVGYIDH
YPELYVIALLTLAFRGTLLPYLLLRIIRRLTIERELEPLLRPGSSLVLGAGAVVFSLVVA
ARMTQALHLTAEVVVLALTVMLSMKLIGYLMLAVRHEAVSHVLGLLVLENGIFLGTQILV
PGMPMLLELVILFDLLIVVVCFGVLVRYLVGQVGSTSALQLRRLVG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggtttcacgcgacgccggtcgaagcctcgctgttcggcgttctcgccatcgcg
agcctgctgcttgccttcgtcatgctcggctcgcgctggctgcggcattacctcatcgcc
ttcgccgcggaatcgtgggcgatcgcgctgctctcggcggcggtcgggtatatcgaccat
tatcccgaactctatgtcatcgcgctgctgaccctggcgttccggggaacgctgctgccc
tacctgctgctccgcatcatccggcggctgacgatcgagcgggaactcgagccgctgctg
cgaccggggtcgagtctggtgctgggcgccggcgccgtcgtgttctcgctcgtcgtcgcc
gcgcggatgacgcaggcgctgcacctgacggccgaggtcgtcgtgctggcgctgacggtc
atgctgtcgatgaagctgatcggctatctgatgctcgcggtgcggcacgaggcggtcagt
cacgttctcgggctgctggtcctcgagaacggcattttcctcggcacgcagattctcgtg
cccggcatgccgatgctgctcgaactcgtgatcctgttcgacctgctcatcgtcgtcgtc
tgcttcggcgtgctggtgcgttatctcgtcgggcaggtcggcagcacgagtgccttgcaa
ctgcggcggctggtgggctga

DBGET integrated database retrieval system