KEGG   Acidiphilium multivorum: ACMV_06790Help
Entry
ACMV_06790        CDS       T01446                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K12141  
hydrogenase-4 component F [EC:1.-.-.-]
Organism
amv  Acidiphilium multivorum
Brite
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     ACMV_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
771153..772673
Genome map
AA seq 506 aa AA seqDB search
MTGIATSVLIGAPALAVLAMLAAPRPRLAERLNLAAAGLCFIAAVAMTVSAPAAGARYLG
RYLIVDPLGAWIILCAAVVYLLASIHACGYMRMPGEEARLPRFYQLFALFALTIFIAPLM
NNPGLYWIAIEMTTVVSTFLVAFEQAAEAIEAGWKYIIIVSAGITLALLGTVIFYWAGTF
SLGPTYDMTWRVLRHAAPHMDRALLVLGFLLVLVGYGTKVGLAPMHTWLPDAHSEGPAPV
SAMLSGALLNAAMAGIVRYLAVLHRAGLFMLPDQILAVFGTASLLVAALFIVRQRGVKRL
MAYSSVEHMGIVALGFGFGGPFGVAGAMYHMLNHSLNKSLMFFGAGNAMRSFGTRSMTRI
RDYARHFPVAAALWLAGAVAITGAPPFGLFASELTILRAGFRGAGLWAAIVMLVLLILIF
IGFLDHFRVMYFEPAGDDAPRPARLGAWTVAPMWLALIPLLVLGLWWPRAMWRDFQTVEQ
VIERPAAAPGPAARASARMPDARRAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggatcgcgacatcggtcctgatcggcgcgccggcactcgcggtgctggcgatg
ctggccgcgccgcggccgcgtctcgcggagcggctcaacctcgccgcggccgggctctgc
ttcatcgccgcggtcgcgatgacggtttccgcccctgccgccggcgcccgctatctcggg
cgctacctgatcgtcgatccgctcggcgcctggatcatcctgtgcgccgcggtggtctat
ctgctcgcctcgatccatgcctgcggctacatgcggatgccgggagaggaagcgcggctg
ccgcggttctaccagctcttcgccctgttcgcgctgaccatcttcatcgcgccgctgatg
aacaatcccgggctttactggatcgcgatcgagatgacgaccgtggtcagcaccttcctc
gtcgcgttcgagcaggcggcggaggcgatcgaggcagggtggaaatacatcatcattgtc
tcggccgggatcacgctggcgcttcttggcactgtgatcttctactgggccgggacgttc
agcctggggccgacctacgacatgacctggcgcgtcctgcggcatgccgcgccgcacatg
gaccgcgcgctgctcgtgctcgggttcctgctcgtgctggtgggctacggcaccaaggtc
gggctggcgccgatgcacacctggctgccggatgcgcacagcgaggggccggcgccggtc
tcggcgatgctctccggcgcgctgctgaacgcggcgatggcgggcatcgtgcgctatctc
gcggtgctgcaccgggccgggctgttcatgctgcccgaccagatccttgcggtgttcggc
accgcctcgctcctggtggcggcgctgttcatcgtgcgccagcgcggggtgaagcggctg
atggcgtattccagcgtcgagcacatgggcatcgtcgccctcggcttcggtttcggcggg
ccgttcggcgtcgcgggcgcgatgtatcacatgctcaaccacagcctgaacaagtcgctg
atgttcttcggcgccggcaacgcgatgcgcagtttcggcacccggtcgatgacgcggatc
cgcgactatgcgcgccactttccggtcgccgcagcactctggctggccggtgccgtcgcg
atcaccggcgcgccgcccttcggcctgttcgccagcgagctgaccatcctgcgcgccggt
ttccgcggcgccgggctctgggcggcgatcgtgatgctggttctgctgatcctgatcttc
atcggcttcctcgatcattttcgcgtcatgtatttcgagccggccggggatgacgcgccg
aggccggcgcggctcggggcctggaccgtcgcgccgatgtggctcgcgctgatcccgttg
ctggtgctgggcctgtggtggccgcgcgcgatgtggcgcgatttccagacggtcgaacag
gtgatcgagcgtccggccgccgcgccggggcctgcggcgcgcgcctcggcccgcatgccg
gatgcgcggagggcgtcgtga

DBGET integrated database retrieval system