KEGG   Acidiphilium multivorum: ACMV_06800Help
Entry
ACMV_06800        CDS       T01446                                 

Definition
(GenBank) putative NADH-ubiquinone oxidoreductase
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
772670..774106
Genome map
AA seq 478 aa AA seqDB search
MNMPSRRGMDPSSIEAAAGALRAAGGRMIMVYAAPEADGRQTLRYVSSRPGIAGFEVWSV
PAGGTVPSIATIWPLLGWYERETADHRGIAFSGQPEPFSLIAPLRADEEADLRRLPGLSG
DAVQVLPFGPVRAGVVESAEFSFFYVGEAILHYVPHLFLKHRGMEDRFVDQTPETGLVLA
ERVSGVGSVAHALAYAQAMEAAAQVAVPGRARYQRVIVAELERLYNHLHYLGHLADTTTL
KVAHAEGALLAERVKQIGARVTGSRFLRGVIAPGGLRRELRVEGLAGALDALRAPIRRYI
ARLDASESHFDRLATTGVLPREVAFDQGATGPVARASGLDRDLRRDHAYAAYDDPDLALA
VATGTDGDAHARARVRIAEIENALLMIERAIALTPGGAIRVACAPAAGAEAMGWAESPRG
TLIYAVHVGPDGRLARVKIKSPSFSNWRVFPYTVHGTNMMDYAINEASFGLTIAGCAR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatgccgtcgaggcgcggcatggacccctcgtccatcgaggccgcggccggcgcg
ctgcgcgctgcggggggccggatgatcatggtctatgcggccccggaggctgacgggcgg
cagacgctgcgctacgtgtcgtcgcgcccggggatcgccggcttcgaggtctggagcgtt
ccggccgggggaacggtgccgagcatcgccacgatctggccgctgctgggatggtatgag
cgggagacggccgatcatcgcggcatcgccttcagcgggcagccggagccgttttcgctg
atcgcgccgctgcgagccgatgaggaggcggatctgcgccggctgccggggctgtccggc
gatgccgtgcaggtgctgccgttcgggccggtgcgggccggcgtggtcgaatcggccgag
ttcagcttcttctatgtcggcgaggcgatcctgcattacgtgccgcacctgttcctcaag
catcgcggcatggaagaccgcttcgtcgaccagacgccggagaccgggctcgtgttggcc
gagcgcgtttcgggggtcggcagcgtggcgcatgcccttgcctatgcgcaggcgatggag
gccgccgcgcaggtggccgttcccggccgcgcgcgctaccagcgggtgatcgtcgccgag
ctcgagcggctttacaatcatcttcattatctcggccatcttgccgatacgacgacgctg
aaggtggcccatgccgaaggcgcgctgcttgccgagcgggtcaagcagatcggcgcccgg
gtgacgggcagccggttcctgcgcggcgtgatcgcgccgggcgggctgcggcgggagctg
cgcgtcgagggtcttgccggggcgctcgatgccctgcgcgcgccgatccgccgctacatc
gcgcggctggacgcctcggaaagccatttcgaccggctggcgacgaccggcgtgctgccc
cgcgaggtggcgttcgaccagggcgcgaccgggccggttgcccgtgcctccggcctcgac
cgcgacctgcggcgcgaccatgcctatgccgcctacgacgatcccgacctcgccctcgcc
gtcgccaccgggaccgacggcgatgcccacgcccgtgctcgcgtgcggatcgccgagatc
gagaatgcgctgctgatgatcgagcgcgccatcgcgctgacgcccggcggcgcaatccgg
gtcgcctgcgcgccggccgccggcgccgaggcgatgggctgggcggaatcgccgcgcggc
acgctgatctatgccgtgcatgtcgggcccgacgggcggctcgcgcgggtcaagatcaag
tcgccctccttctccaactggcgggtgtttccctacaccgtgcacggcacgaacatgatg
gactacgcgatcaacgaggcgagtttcggcctgaccatcgccggatgcgcgcgatga

DBGET integrated database retrieval system