KEGG   Acidiphilium multivorum: ACMV_06860Help
Entry
ACMV_06860        CDS       T01446                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
amv  Acidiphilium multivorum
Pathway
amv00521  Streptomycin biosynthesis
amv00523  Polyketide sugar unit biosynthesis
amv01130  Biosynthesis of antibiotics
Module
amv_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ACMV_06860 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACMV_06860 (rfbC)
Enzymes [BR:amv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ACMV_06860 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: BAJ80033
NITE: ACMV_06860
UniProt: F0IXU4
Position
complement(778919..779473)
Genome map
AA seq 184 aa AA seqDB search
MIEPLDLPGVMLITPPRFADSRGWFSETWNQARLAALGFTETFVQDNHSSSTRPGTIRGL
HCQLAPFAQGKLVRCIRGAIWDVAVDIRHGSPSFGRHAAAELSAANGRQLWIPPGFLHGF
CTTEPDTEVVYKVTAPYDKASERGVIWNDPDLALPWPVPAGTALLSDKDNLLPRLAEAEP
WFRL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagccgctcgacctgcccggcgtcatgctcatcaccccgccccgcttcgccgat
tcccgcggctggttcagcgaaacctggaaccaggcaaggctcgccgccctcggcttcacc
gaaaccttcgtgcaggacaaccactcctcctccacccgcccaggaaccatccgcggcctg
cactgccagctcgcccccttcgcccagggcaagctcgtccgctgcatccgcggcgcgatc
tgggacgtcgccgtcgacatccgccacggctcgcccagcttcggacgccacgccgccgcc
gagctctccgccgccaacgggcgccagctctggatcccgcccggcttcctgcacggcttc
tgcaccaccgagcccgataccgaggtcgtctacaaggtcaccgccccctacgacaaagcc
tccgaacgcggcgtcatctggaacgatcccgatctcgccctgccctggcccgtccccgcc
ggcaccgccctcctctccgacaaggacaatctcctgccccgcctggccgaggccgaaccc
tggttcaggctctga

DBGET integrated database retrieval system