KEGG   Acidiphilium multivorum: ACMV_06910Help
Entry
ACMV_06910        CDS       T01446                                 

Definition
(GenBank) putative transposase
  KO
K07497  
putative transposase
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
782090..782437
Genome map
AA seq 115 aa AA seqDB search
MQNGDVESFSGRMRDELLNESLFFGLDHARAAIADWVAHFNAARPHSSLGYQTPADYAEG
LTTTGTERRNRSGRDSNRTRMKVRGRVRDILFRPFARPLAAGARRRILWTESSYR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacggcgatgtcgaatccttcagcggccgcatgcgcgacgagcttttgaacgag
agcctgttcttcggcctcgatcatgcccgcgccgccatcgctgattgggtggcgcatttc
aatgccgcgaggccgcactcctcgctcggctaccagaccccggcggactatgccgagggc
ctcaccacaaccggcaccgaacggcgtaacagaagcggccgagactccaatcgcacacgg
atgaaagttcggggacgggtcagagacattcttttcaggccattcgcgcgcccccttgcc
gcaggggcgcggcggcgcatactctggaccgagagctcatacaggtga

DBGET integrated database retrieval system