KEGG   Acidiphilium multivorum: ACMV_06940Help
Entry
ACMV_06940        CDS       T01446                                 

Gene name
recO
Definition
(GenBank) DNA repair protein RecO
  KO
K03584  
DNA repair protein RecO (recombination protein O)
Organism
amv  Acidiphilium multivorum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACMV_06940 (recO)
DNA repair and recombination proteins [BR:amv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ACMV_06940 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ACMV_06940 (recO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
784839..785594
Genome map
AA seq 251 aa AA seqDB search
MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA
RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG
GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW
APRLLKLPAFLLDEDAADDEADLAACRDGLALTGHFLARDAFGARHAPLPTARLGLYDRL
TRRLNGDDDAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaatggagcgaacccgcgatcgtcctcagcgttgccgcgttcggcgagagcgatctg
cggaccatcgtcctggccgagacgcatggcgcctggcacgggctggcgcgcggcggggcg
gggcggcgcggggcgccgatctggcaggaaggcaatctgatcaacgcccgctgggtcgcg
cgcctgccggaacagctcggcagcatcagcggggagctggtgcatcccgccgccgcgatc
gcgatggcggacccgctggcgctggcggtgctgcgcgcggcctgtgccgtcgcggcgggt
gcgctgccggagcgcgaggcgcatcgcggcgcgttcatccggcttgcgcggctgctgggc
ggcatcggcatcgccggcaccgcgctgccggcgctggtgcgcttcgaactcgaattgctg
cgcgagctcggctacgggctcgatctgtcgtcctgcgcgctgtccggggcggccgaggat
ctcgccttcgtttcgccgcgcaccggccgcgcggtggcgcgcggcgcagccggcgattgg
gcgccgcggctgctgaagctgccggccttcctgctcgacgaggatgccgcggacgatgag
gccgaccttgctgcctgccgcgacgggctggcgctgaccggccatttcctcgcccgcgat
gcgttcggcgcgcgccatgccccgcttcccacggcccggctcggcctctatgaccggctg
acccgcagactgaacggagacgacgatgcccgatga

DBGET integrated database retrieval system