KEGG   Acidiphilium multivorum: ACMV_06960Help
Entry
ACMV_06960        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
787805..789871
Genome map
AA seq 688 aa AA seqDB search
MTPADAPSRLTDRAGLPLTGGSLALNFRAVSLLEGIRAAIAVAGTLAAGALLDQPQLALA
ALGALLACFTDPGGALPARLPPMLIFGVAGAICLGGFGLLDGASPLLAIPVAGLTIFCCS
LARIYGQGGLLTGNLLAVTIVLALDMPTGSPVAALHAAFGFWAGAAEAAILTLALWRIRP
FGPARAALADAALALAELARDLAEREADAGGETGFDLHARGHRRAVREAIERARAVTQAT
LRRRGVASQRANALVLRLATFDQLFGALIALGEEMAARGADDPAARRALAGIGDLLGAMA
PELEAGRTLDTAPLRAGLEALRGTVSSAKGDPALRRPLAAALDRLSVLITVSNAPGVTAA
DEIVPPDLMATILGPLRSNLSLASVPLRHALRSMLVAIPALAFVAWLGNPFGHWLAITVI
LVLQPHFSATWIRAIERVGGTAAGGLVAAAIGLLVHTRLELAVAMVPLTLFAFAVRGVNY
SAWVVLLTPMIVLLIEQIDPGANQWVVAASRVGFTLAGGILAVAANLVLWPSFEGNRLGA
ARRDAIAAHRAYLVAAFAHLTADAPPPEAARRQAGLASNNLEASIARVMMEPHRDDDPLL
RAAIVTDAALRRTAGRLAALALEPRPEAAARAGCRAWAEALAAWFDPDLPDPPPLPPPVG
LPAIDDGLARLARQAELVREPVTSETIA
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggctgatgcgccctcccggctgaccgatcgtgcagggttgccgcttacgggc
ggcagcctcgcgctgaacttccgcgccgtctccctgctcgagggaattcgtgccgcgatt
gcggtcgccggcacgctcgcggcgggcgccctgctggaccagccgcaactcgccctcgcg
gcgctcggcgcgctgctcgcctgctttaccgatccaggcggcgcgctgccggcgcgcctg
ccgccgatgctgatcttcggcgtggccggcgcgatctgcctcggaggtttcgggctgctg
gacggcgccagcccgttgcttgccattcccgtcgcggggctcaccatcttctgctgcagc
cttgcccgcatctacgggcagggcggattgctgaccggcaacctgcttgccgtcacgatc
gtgctggcgctcgacatgccgaccggctcgccggtcgccgcattgcatgcggccttcggc
ttctgggccggcgccgcggaagccgcgatcctgacccttgcgctctggcgcatccgtccg
ttcggcccggcgcgcgcggccctggcggatgcggcgctcgcgctggccgagctcgcccgc
gatcttgccgaacgcgaggccgatgccggcggcgagaccgggttcgatttgcacgcccgc
ggccatcgccgggccgtgcgcgaagcgatcgagcgcgcccgcgccgtcacccaggccacc
ctgcgccggcgcggcgtggcaagccagcgggcgaacgcgctcgttcttcgcctggccact
tttgaccagctgttcggcgcgctgatcgcgctgggtgaggaaatggccgcgcgcggcgcc
gacgatcccgccgctcgccgcgccctcgccggcatcggcgacctgctgggagcgatggcg
cccgaactcgaagccggccgcacgctggatacggcgccgctccgtgccgggctggaggct
ctgcgcggcacggtctcctcggcgaagggcgatcccgcgctgcgccgtccgctggccgcc
gcgctcgaccgcctttcggtgctcatcaccgtctcgaatgcgccgggcgtcacggccgcc
gacgagatcgtgccgcccgacctgatggccacgatccttggcccgttgcggtccaatctc
agcctggcctcggtgccgctgcgccacgccctgcgctccatgctggtcgcaatcccggcg
ctcgccttcgtcgcctggctcggcaacccgttcggccattggctcgccatcaccgtgatc
cttgtgctgcagccgcatttctcggccacatggatccgcgcgatcgaacgcgtcggcggt
accgcggcgggcgggctggttgccgccgccatcggcctgctggttcacaccaggctggaa
ctcgcggtggcgatggtgccgctcacgctgttcgccttcgccgtgcgcggggtgaactac
agcgcctgggtcgttctgctcacgccgatgatcgtgctgctgatcgagcagatcgatccg
ggggcgaatcagtgggtcgtcgccgcctcgcgcgtcggtttcacgctggccggcggcatc
ctcgcggttgccgccaatctcgtgctctggccgagtttcgagggtaaccggcttggcgcg
gcgcggcgcgacgccattgccgcgcaccgcgcctatctcgtcgcggccttcgcgcatctg
accgccgacgcgccgccgcctgaggccgcgcgccggcaggcggggctggccagcaacaat
ctcgaagcctcgattgcgcgggtgatgatggagccgcatcgcgacgacgacccgctgctg
cgcgccgcgatcgtcaccgatgccgccctgcgccgcacggccggcaggctggcggcactc
gccctcgagccccgcccggaggcagcggcccgggccggctgccgggcctgggccgaggcg
ctcgccgcctggttcgatcccgacctgccggacccgccgcccttgccgccgccggtgggc
ctgcccgcgatcgatgacgggcttgcgcggctggcccggcaggcggaacttgtccgtgaa
cccgtgacttcggagaccatcgcatga

DBGET integrated database retrieval system