KEGG   Acidiphilium multivorum: ACMV_06980Help
Entry
ACMV_06980        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF563
Motif
Other DBs
NCBI-ProteinID: BAJ80045
NITE: ACMV_06980
UniProt: F0J4J3
Position
complement(790386..791402)
Genome map
AA seq 338 aa AA seqDB search
MPAPLPMPRPADPEFIAPEWIRLHAEAPREAFDLALLGPMRARLAGPGLVWHGGALLDDE
SVMPVYVRRIVHEDDGAMPARLATLPPRREARPAFVFHGWGVRVYGHLLIEMLPKLLLAA
RFSPLLSGALPVLDRQMPDWFITILHDHLGIDPEQAIWFDSAHERLDLDRAIILPLLGRR
GGYHPLTGSLIDDFIARTTRPPAAPVPRIFVARGDFANPDAPQRRYVNESEIAAIARDEF
GFAVLRPETLPFAEQVGLFAGARAIVGPMGSGLHNAIFAGPDCVTGVIRCHALDQSAIAA
LRGQRIGLLSEGIHETAPQAYRVEPDRFRRFLAALLQS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgccgcttcccatgccacgcccggcggacccggaattcattgcgccggaatgg
atccggctccacgccgaggcgccgcgcgaggccttcgatctcgccctgctcgggccgatg
cgggcgcgcctcgccgggccggggctggtatggcatggcggcgcgctgctcgatgacgaa
agcgtcatgcccgtctatgtccgccgcatcgtgcatgaggatgacggggcgatgccggcg
cgcctcgccaccctgccgccgcggcgcgaggcgcggccggccttcgtctttcacggctgg
ggcgttcgggtctacggccaccttctgatcgagatgctgccgaagctgctgctcgccgcc
cggttttcgccgctgctgtctggcgccctcccggtgctcgaccgccagatgccggactgg
ttcatcacgatcctgcacgatcatctcggcatcgatcccgaacaggccatctggttcgac
tcggcgcacgagcgactcgatctcgaccgcgccatcatcctcccgctgctcggccggcgc
ggcgggtatcatccgctgaccggatcgctgatcgacgatttcatcgcccgcacaacccgc
ccgccagcagcacccgtgccacggatcttcgtcgcccgcggcgatttcgccaatcccgat
gcgccgcaacgccgctacgtcaacgagagcgagatcgccgccatcgcccgcgacgaattc
ggcttcgccgtgctgcggccggaaaccctgcccttcgccgaacaggtcgggctgttcgcc
ggcgcgcgggcgatcgtggggccaatgggctcgggcctgcacaatgcgatcttcgccggg
ccggactgcgtgaccggggtgatccgctgccacgcgctcgaccagtcggcgatcgccgca
ctgcgcggccagcggatcggcctgctgagcgaaggcatccacgagaccgcgccgcaggcc
tacagggtcgagcccgaccggttccgccgcttcctcgcggcgctgcttcagtcgtga

DBGET integrated database retrieval system