KEGG   Acidiphilium multivorum: ACMV_07040Help
Entry
ACMV_07040        CDS       T01446                                 

Gene name
xseB
Definition
(GenBank) exodeoxyribonuclease VII small subunit
  KO
K03602  
exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
amv  Acidiphilium multivorum
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:amv00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    ACMV_07040 (xseB)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     ACMV_07040 (xseB)
DNA repair and recombination proteins [BR:amv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     ACMV_07040 (xseB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
796141..796407
Genome map
AA seq 88 aa AA seqDB search
MAAAKPDAGAPESGPDIDKLSFEDALAELERIVRGLETGQQKLEDAIAAYERGSRLKQHC
EARLAEAESRVQSIVARADGSLALKDDQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagccaagccggacgccggcgccccggagtcgggaccggacatcgacaagttg
tccttcgaggatgccctggccgagctggagcgcatcgtgcgcgggctcgaaaccgggcag
cagaagctcgaggacgccatcgccgcgtatgagcgcggcagccgtctgaagcagcattgc
gaggcgcggctggccgaggccgagagccgcgtgcagtcgatcgtcgcccgcgccgacggc
tcccttgccctgaaggacgaccaatga

DBGET integrated database retrieval system