KEGG   Acidiphilium multivorum: ACMV_07100Help
Entry
ACMV_07100        CDS       T01446                                 

Definition
(GenBank) putative fatty-acid--CoA ligase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
amv  Acidiphilium multivorum
Brite
Enzymes [BR:amv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     ACMV_07100
Lipid biosynthesis proteins [BR:amv01004]
 Acyl-CoA synthetase
  Unknown
   ACMV_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(801138..801722)
Genome map
AA seq 194 aa AA seqDB search
MAVAWGGWYPVRNETPHHAEDTTMTDFITGLEKTEANYQALSPLSFLARTAKVWPERTAI
VHGSIRRTWAETFERCKRLGAALAARGIGPGDVVAVMAPNIPAMVEAHFGVAMAGAVLNT
LNTRLDAPTIAYILRHGEAKLLLSDTEFAPVIAAALAELSDNAPPVIDIDDPEGPGGARL
GAMDLAYPVVTHTH
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagcatggggcggctggtatcctgtccgcaacgaaacgccacaccacgccgag
gacacgaccatgaccgatttcatcaccggcctcgagaagacggaagcgaactaccaggcg
ctgtcgccactctccttcctcgcgcggacagcgaaagtctggccggagcgaacggcgatt
gttcacggctcgatccggcgcacctgggcggaaaccttcgagcgctgcaagcggctgggc
gcggcactggcggcacggggaatcggaccgggcgacgtcgtcgccgtcatggcgcccaac
ataccggcaatggtcgaggcgcatttcggcgtcgccatggcgggcgcggtgctgaacacg
ctgaacacccggctggatgcgccgaccatcgcctacatcctgcgccacggcgaggcgaaa
ctcctgctgagcgacaccgaattcgccccggtgatcgccgcggccctggccgagctcagt
gacaatgctcctccggtgatcgatatcgacgatcccgagggcccaggcggcgcccggttg
ggagcaatggaccttgcctatccggttgttacccacacccactaa

DBGET integrated database retrieval system