KEGG   Acidiphilium multivorum: ACMV_07120Help
Entry
ACMV_07120        CDS       T01446                                 

Gene name
guaB
Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
amv  Acidiphilium multivorum
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACMV_07120 (guaB)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     ACMV_07120 (guaB)
Exosome [BR:amv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACMV_07120 (guaB)
  Exosomal proteins of breast cancer cells
   ACMV_07120 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
802542..804041
Genome map
AA seq 499 aa AA seqDB search
MAPSNETFLPRGSDRITEAYAFDDVLLVPGYSSVLPAAVNTRTRLTRSISLNIPVISAAM
DTVTEAPMAIAMAQQGGIGVVHKNLSIEDQADQVRQVKKFESGMVVNPLTIHPEQTLAEA
QALMAQHRISGVPVVERDTNRLVGILTHRDVRFATDPAARVYELMTRENLVTAPANVAPE
VARSLLHKHRIEKLLVVDEDYRCVGLITVKDMDKAEAHPFANKDELGRLRVAAATGVGED
GARRAEALIAAGVDVVVVDTAHGHSEGVLRAVARIKERSNAVQIVAGNVATPEAAAALIK
AGADAVKIGIGPGSICTTRVVAGVGVPQFSAVMETAAACHEADVPAIADGGIRTSGDVVK
ALAAGADCVMIGSLLAGTDEAPGEVFLYQGRSYKSYRGMGSLGAMARGSADRYFQQDIKD
SLKLVPEGIEGRVGYKGPMAGVVHQLVGGLRAGMGYTGCATIADLQTRAQFRRITGAGLR
ESHVHDVAITREAPNYRQD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcaatgagacttttctcccgcgaggctccgaccgcatcacggaggcttat
gccttcgacgatgtgctcctcgttcccggctattcctcggtgctccccgccgcggtcaac
acccgcacgcggctgacccgctccatctcgctcaacattcccgtcatctccgccgcgatg
gacaccgtgacggaggcgccgatggcgatcgccatggcgcagcagggcggcatcggcgtg
gtgcacaagaacctctcgatcgaggatcaggcggaccaggtgcgccaggtcaagaaattc
gagagcggcatggtggtcaacccgctcaccatccaccccgagcagaccctggccgaggcg
caggcgctgatggcccagcatcggatttccggcgttcccgtggtcgagcgcgacaccaac
cgccttgtcggcatccttacccatcgtgacgtccgcttcgcgaccgacccggccgcccgc
gtgtatgagctgatgacgcgcgaaaacctcgtcaccgcgccggccaatgtcgcgcccgag
gtcgcgcggtcgctgctccacaagcaccggatcgagaagctgctggtggtggacgaagac
tatcgctgcgtcggcctgatcaccgtgaaggacatggacaaggccgaggcgcatcccttc
gccaacaaggacgaactcgggcgcctgcgcgttgccgcggcgaccggcgtcggcgaggac
ggggcgcgccgcgccgaggcgctgatcgccgcgggggtggatgtcgtggtggtggatacc
gcgcatggccattcagagggcgtgctgcgcgccgtagcgcgcatcaaggagcgttcgaac
gcggtgcagatcgtcgccggcaacgtcgcgacgcccgaggccgccgcggcgctgatcaag
gcgggtgctgacgcggtgaagatcggcatcggcccgggcagcatctgcaccacccgcgtg
gttgccggcgtcggcgtgccgcagttctcggccgtgatggagaccgccgccgcctgtcac
gaagcggacgtgccggcgatcgccgatggcgggatccgcacctcgggcgacgtggtcaag
gcgctcgccgccggggccgactgcgtgatgatcggctcgctcctcgccggcaccgacgag
gcgcccggcgaggtgtttctctaccagggccggtcctacaagtcctatcgcggcatgggc
agcctgggtgcgatggcccgcggctcggccgaccgctatttccagcaggacatcaaggac
tcgctgaaacttgtgcctgaggggatcgaggggcgcgttggctacaagggcccgatggcc
ggggtggtgcaccagctggtcggcgggctgcgcgccggcatgggctataccggttgcgcc
accatcgccgacctgcagacaagggcgcaattccgccgcatcaccggcgccggcctccgc
gagagccacgttcatgacgtggcgatcacccgcgaggcgccgaattaccggcaggactga

DBGET integrated database retrieval system