KEGG   Acidiphilium multivorum: ACMV_07130Help
Entry
ACMV_07130        CDS       T01446                                 

Definition
(GenBank) putative RNA methyltransferase
  KO
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
amv  Acidiphilium multivorum
Brite
Enzymes [BR:amv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     ACMV_07130
Ribosome biogenesis [BR:amv03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    ACMV_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
804045..805325
Genome map
AA seq 426 aa AA seqDB search
MTPAGRLQAAIELLGTIEADRRPADAIANDFLRTRRFIGGGDRREIGEIVWSVLRARRRL
GWWLERVGAEATPRLLIASLRVLTGMPAPRVAGLFGVMRFAPPPLEAAERRALDRLDTHT
LDHPSMPEAVRLEMPDFVLPLLRERFGDKLESECAALMQPAPLDLRVNLLKATRDEALAA
LAAAGLKAEPTRLSPWGLRLPGRQNVTVAAPFRDGLVEIQDEGSQLVALLAGAQPGMRVA
DYCAGAGGKTLALAMTMANKGHIIACDVSAPRLDGAIRRLRRAGVHNAERHLLESGDKWV
KRQEKKFDRVLVDAPCTGAGTWRRNPDARLKLTETDLAELTAKQAAILDAAQRLVKPGGR
LVYATCSVLRPENEAQIESFLARHSDFAIVPVADGLPAYLHGDMLRLSPARDGTDGFFAC
RMERRG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgacccccgcgggccggctgcaggcggcgatcgagctgctcggcacgatcgaggccgat
cgccggccggccgatgccatcgccaacgacttccttcgcacgcgccgcttcatcggcggc
ggtgaccggcgcgagatcggcgagatcgtctggtcggtgctgcgtgcccgccgccggctc
ggctggtggctggagcgggtcggcgccgaggcgacgccgcgcctgctcatcgcctccctg
cgcgtgctcaccggcatgccggcgccgcgcgtcgccgggctgttcggcgtgatgcggttc
gccccgccgccgctcgaagctgccgagcggcgcgcgctcgaccggctcgacacccatacg
ctcgaccatccgtcgatgcccgaggcggtgcggctggaaatgcccgatttcgtgctgcct
ttgctgcgcgagcgctttggcgacaagctcgagtcggaatgcgcggcgctgatgcagccc
gcgccgctcgatctgcgggtcaacctgctcaaggccacgcgcgatgaggcgctcgccgcc
ctggccgccgccgggctgaaggccgagccaacgcggctcagcccctggggcctgcgcctt
cctggccgtcagaacgtcactgttgcggcaccgtttcgcgacgggctcgtggaaatccag
gacgagggcagccagctcgtcgccctgctcgccggggcgcagccgggtatgcgcgtcgcc
gattactgcgctggcgctggcggcaagacgctggctctggcgatgacgatggccaacaag
ggccacatcattgcctgcgacgtgtccgcgccgcggctcgatggggcgatccgccggctg
cgccgcgccggtgtgcacaatgccgagcgacacctgctcgaatccggcgacaaatgggtg
aagcggcaggagaagaaattcgaccgcgtgctggtcgacgccccctgcaccggcgccggc
acctggcgccgcaaccccgatgcacggctgaagctgaccgagacagatctcgccgaactc
accgccaagcaggcggcgatcctggatgccgcgcaacgcctggtcaaacccggcggccgg
ctggtttatgccacctgctcggtgctgcgcccggaaaacgaggcgcagatcgagagtttt
ctcgcgcggcattccgatttcgcgatcgtccccgtcgccgacggcctgccggcctatctg
catggggacatgctgcgcctgtcccccgcgcgcgacggcaccgacgggttcttcgcctgc
cggatggagcggcgcggatga

DBGET integrated database retrieval system