KEGG   Acidiphilium multivorum: ACMV_07160Help
Entry
ACMV_07160        CDS       T01446                                 

Definition
(GenBank) putative biopolymer transport protein ExbD/TolR
  KO
K03559  
biopolymer transport protein ExbD
Organism
amv  Acidiphilium multivorum
Brite
Transporters [BR:amv02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACMV_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(806765..807178)
Genome map
AA seq 137 aa AA seqDB search
MRRRRDHLERERPRLEIVPMIDIMMFLLVFFVMIVLKMIPDSGVALKLPGAQTAKEMKPA
QVVVMIDAAGKLHVKNQMVTLAGLQTYLGQVVAAKRKVDVVIAGDKDIRYQRLMQVMDTV
RKSGIVNVGLATKRPGG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcagacgcgatcatctggagcgcgaacgcccccggctcgaaatcgtgccgatg
atcgacatcatgatgttcctgctcgtgttcttcgtgatgatcgtgctcaagatgatcccc
gattccggcgtcgcgctgaagctgccgggcgcgcagacggcgaaggagatgaaaccggcc
caggtggtggtgatgatcgacgctgccggcaaactgcacgtgaagaaccagatggtcacg
ctggcggggctgcagacctatctcggccaggtcgtggccgcgaaaaggaaggtcgatgtc
gtcatcgccggggacaaggatatccgctaccagcggttgatgcaggtgatggacaccgtg
cgcaaatccgggatcgtcaatgtcgggctcgcgaccaagcggcccggcggctga

DBGET integrated database retrieval system