KEGG   Acidiphilium multivorum: ACMV_07170Help
Entry
ACMV_07170        CDS       T01446                                 

Definition
(GenBank) putative proton channel MotA/TolQ/ExbB
  KO
K03561  
biopolymer transport protein ExbB
Organism
amv  Acidiphilium multivorum
Brite
Transporters [BR:amv02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACMV_07170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(807182..807853)
Genome map
AA seq 223 aa AA seqDB search
MNEIVRLVMMTGGLLAVMPVLLLVTLVVGLERFWLLKRTLGAGRRIHAALRAVGYGNPAG
LRQLAETNGATLQGHLIATALASRGENADELDNHLEEEIMDAMPRITRGLWILDTAVTIA
PLLGLFGTIIGMIQAFDVLSSNGGPAKVTGGIADALVSTGAGLLIAIIAVYLVNYFNNLS
RQIVLQLELIKVVLINRLHGRGLAGDDAVEDPPKRRAASMARV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatcgtccgcctcgtcatgatgacgggtggtctgctggcggtgatgccggtt
ctgctgctggtgacactcgtcgtcgggctcgaacggttctggctgctcaagcgcacgctc
ggcgccgggcggcgcatccatgccgcgctgcgcgccgtgggttatggcaatccggccggg
ctgcgccagctcgccgagacgaacggcgccacgctgcagggccacctgatcgcaaccgcg
ctggcctcgcgcggggaaaacgccgacgaactcgacaatcacctcgaggaagagatcatg
gacgccatgccgcggatcacccggggcctgtggattctcgataccgcggtgacgatcgcg
ccgttgctcgggctgttcggcacgatcatcggcatgatccaggccttcgacgtgctgtcg
agcaacggagggccggcgaaggtgacaggcgggatcgccgatgcgctggtctcgaccggc
gcgggcctgctgatcgcgatcatcgccgtatatctggtcaattatttcaacaatctcagc
cgccagatcgtcctgcagctcgaactcatcaaggtggtgctgatcaaccgtctgcacggg
cgcgggctggccggcgacgacgcggtggaggatccgcccaagcggcgcgctgccagcatg
gccagggtctga

DBGET integrated database retrieval system