KEGG   Acidiphilium multivorum: ACMV_07200Help
Entry
ACMV_07200        CDS       T01446                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K02033  
peptide/nickel transport system permease protein
Organism
amv  Acidiphilium multivorum
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ACMV_07200
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    ACMV_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(810539..811483)
Genome map
AA seq 314 aa AA seqDB search
MILSRLAASALTLVLLVTIVFFMVHATPGGPAYSILGQKATPEAVRQLNVRLGLSAPLWK
QYLVWWAHLLEGRLGYSYLLNRPVAGLIAAYAANTLALYLGAITLSVLLSIAIGLVQGAF
WGQWPARLIGAAQLVLYAMPVFFAGTILILYVAVKWRWLPAGGIADIRHAAPGVADYARH
LILPVVTVGLLGTAGLSRYFGAAVHEELGKDYVRTALAKGLGFGAVLRRHVLRNALRPLV
TILGLSFPYIFAGSVLVETVFDYPGLGFLLWRSALSQDYPVISAIVLLIGVLTVIGNLLA
DLVNGWLDPRERFE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctttcgcgcctcgccgcttcggcgctgacgctcgtgctgctggtgacgatcgtg
ttcttcatggtgcatgcgacgcccggcggcccggcctattccatcctcggccagaaggcg
acgccggaggcggtgcgccagctcaatgtccggctcggcctctcggcgccgttgtggaag
cagtatctggtctggtgggcgcatcttctcgaagggcggctcggctattcctatctgctg
aaccggccggtggccggcctgatcgcggcatacgcggcgaacaccctcgccctctatctc
ggcgccatcaccctttcggtgctgctttcgatcgccatcgggttggtgcagggggccttc
tggggccagtggccggcgcggctgatcggtgcggcgcagctcgttctctacgccatgccg
gtgttcttcgccggcacgatcctgatcctctatgtcgcggtgaaatggcgctggcttccg
gcaggcggcattgccgatatccggcacgccgcaccgggagtggccgattacgcccgacat
ctgatcctgccggtggtcaccgtcgggctgctgggaaccgccgggctgtcgcgctatttc
ggcgcggcggtgcatgaggaactcggcaaggactacgtgcgcacggcgctggccaagggg
ctcgggtttggcgccgtgctgcgccggcacgtcttgcgcaacgcgctgcgaccgctggta
acgattctcggcctgtcctttccctacatcttcgcgggctcggtgctggtcgagaccgtg
ttcgactatccggggctcggcttcctgctgtggcgatcggcattgtcgcaggattatccg
gtgatttccgcgatcgtgttgctgatcggcgtgctgacggtgatcggcaacctgctcgcc
gacctggtcaatggctggctcgatccgcgggagcgcttcgaatga

DBGET integrated database retrieval system