KEGG   Acidiphilium multivorum: ACMV_07220Help
Entry
ACMV_07220        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K03832  
periplasmic protein TonB
Organism
amv  Acidiphilium multivorum
Brite
Transporters [BR:amv02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ACMV_07220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(813166..813915)
Genome map
AA seq 249 aa AA seqDB search
MRTEGATANGAIPPWQPDELGLPRATAAGLVIVGLIAAAAFYAARHLPRYRTPLAPATTV
HLVRLAPPLPLPPQPVQPPPPPLPVPPPPVPPPPQPKPLPPPPAPSPMPPPKPLPNVVHH
PPPPPHPRPKPQPVHRPVPHPAPPPPRAKRPPPQPAFDFAQYAAGLRGPLQREVHVTQTM
RMLGVNGTAFIEFTLAPNGKLLSAQVYRSSGNPLIDRAALDAVRHHRFPPFPGTEDKTFA
VPIEIRVGE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaggacggagggggcgaccgcgaacggcgccattccgccctggcagccggacgagctg
ggcctgccgcgggcgacggcggcggggctggtgattgtcgggctgatcgccgccgcggcg
ttctacgccgcgcgccatctgccgcgctaccgcacaccgctggcgcccgccaccaccgtg
catctggtccggctcgcgccccccctgcccttgccaccgcagccggtgcagccgccgcca
ccgccgctacccgtgcctcccccgccggttccgccgccgccgcagccgaaaccgctgcca
ccgccgcccgcaccctcacccatgccgccgcccaagccgctgccgaacgtggtgcaccat
ccgccaccgccaccgcacccgcggcccaagccgcagccggtccatcgcccggtgccgcat
ccggcgccgccgccacccagggcaaagaggccaccgccgcaaccggccttcgatttcgcg
caatacgccgccggacttcgcgggccgctgcagcgcgaagtgcatgtgacgcagacaatg
cgcatgctcggcgtgaatggcacggcattcatcgagttcaccctggcgccgaacggaaag
ctgctttcggcgcaggtctaccgcagcagcggcaacccactgatcgaccgcgcggcgctg
gatgccgtccggcaccaccgcttcccgcccttccccggcacggaggacaagaccttcgcg
gtgccgatcgagatcagggtcggggagtga

DBGET integrated database retrieval system