KEGG   Acidiphilium multivorum: ACMV_07280Help
Entry
ACMV_07280        CDS       T01446                                 

Gene name
coaD
Definition
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  
pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
amv  Acidiphilium multivorum
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ACMV_07280 (coaD)
Enzymes [BR:amv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     ACMV_07280 (coaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
819595..820104
Genome map
AA seq 169 aa AA seqDB search
MADGGLIGLYPGTFDPITNGHLDIIGRAAQLCSKLVIGVARNAGKGPLFPTAERVEMVRA
EIAPIAERTGTEIDVQAFDSLLIAFAQQVSAQVIVRGLRAVSDFDYEFQMAGMNARLDQR
IETIFLMASERHQFISSRFVKEIAQLGGDISSFVPKLTLERTLRRVGRP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggcggtctgatcggtctgtatccgggaactttcgatccgatcaccaacggg
catctcgacattatcggccgcgccgcccagctctgctcgaagctggtcatcggcgtggcc
cgcaatgccggcaaggggccgctgtttcccaccgccgagcgcgtcgagatggtccgcgcc
gagatcgcgccgatcgccgaacgcacgggcaccgaaatcgatgtgcaggcgttcgattcg
ctgctgatcgcctttgcccagcaggtcagcgcacaagtgatcgtgcgcgggttgcgcgcc
gtctccgacttcgattacgagttccagatggccgggatgaatgcacgactcgaccagcgg
atcgagacgatcttcctgatggcaagcgagcggcaccagttcatctcgtcgcgtttcgtc
aaggagatcgcccagctgggcggcgacatctcgagcttcgttccgaaactgacgttggag
aggacccttcgccgggttggcagaccatga

DBGET integrated database retrieval system