KEGG   Acidiphilium multivorum: ACMV_07310Help
Entry
ACMV_07310        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
824774..827596
Genome map
AA seq 940 aa AA seqDB search
MGATGAMGATGATGATGATGATGATGATGATGATGATGATGAMGATGATGATGATGATGA
MGATGATGAMGATGATGATGATGATGATGATGAMGATGAMGATGAMGATGATGATGATGA
TGATGATGATGATGATGATGAMGATGATGATGATGATGAMGATGATGATGATGATGAMGA
TGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGA
TGAMGATGATGATGATGATGATGATGATGAMGATGATGATGATGATGATGATGATGAMGA
TGATGATGATGAMGATGATGATGATGATGAMGATGATGATGATGATGATGATGATGATGA
TGATGATGATGATGATGATGAMGATGATGATGATGATGATGATGATGATGATGAMGATGA
TGATGATGATGATGATGATGATGATGATGATGATGATGATGATGAMGATGATGATGATGA
TGATGATGATGAMGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGA
TGATGATGATGATGATGAMGATGATGATGATGATGATGATGAMGATGATGATGATGATGA
TGATGATGATGATGATGATGATGATGATGATGATGATGGNPCFAEGTRIATVRGDVPVEE
LVAGDVVVLHDGGTAPVVWLGYRTIDLDRHARPEAVQPIVIDAGAIADGIPVRDLIVSPD
HAFYLDGVLIPAKALVNGATIRQLRRSQVTYFHVELPQHAVLLAEGMAAESYLETGNRPA
FENGGDAIILHPDFAQALRETGSCAPFAEEGAIVERVRARILARAGIETTDDADLKIRYR
ADGAAVITSRTAIPGYLTPDPRDRRVLGVKIGAMMLGDEPIALDHPALTEGWHDVEADGR
WTGGAAVVPASLINGRTLTITVVGTLAYPAHGANRSVEAG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaccggcgcgatgggtgccaccggcgcaacgggtgcgacgggtgccaccggc
gcaacgggtgccaccggcgccacgggcgcaaccggagccaccggcgcgacgggtgccacg
ggcgcgatgggtgcgacgggtgccacgggcgcaacgggtgccaccggagccacgggcgcg
atgggtgcgacgggtgccacgggcgcgatgggtgcgacgggtgccaccggcgcaacgggt
gccaccggcgcgacgggtgccacgggcgccaccggcgcgatgggtgccaccggcgcgatg
ggtgccaccggcgcgatgggtgccaccggcgcaacgggtgcgacgggtgccaccggcgca
acgggtgccaccggcgccacgggcgcaaccggagccaccggcgcgacgggtgccacgggc
gcgatgggtgcgacgggtgccacgggcgcaacgggtgccaccggagccacgggcgcgatg
ggtgcgacgggtgccaccggcgcaacgggtgccaccggcgccacgggcgcgatgggtgcc
acgggcgcgacgggtgccaccggcgcgacgggtgccacgggcgcaaccggagccaccgga
gccaccggcgcgacgggtgccacgggcgcaacgggcgcgacgggtgcgacgggtgccacc
ggagccacgggtgccaccggcgcaacgggtgccaccggagccacgggtgccacgggcgcc
acgggcgcgatgggtgccaccggagccacgggtgccaccggcgcgacgggtgccacgggc
gccacgggtgcgacgggtgccaccggcgcgatgggtgccacgggtgcgacgggtgcgacg
ggcgcaacgggtgccaccggcgcgacgggtgccacaggcgccacgggcgcgatgggtgcc
acaggcgccaccggcgcgacgggtgccaccggcgcgatgggtgccaccggagccacgggt
gccaccggcgcgacgggcgccacgggcgcgatgggtgccaccggagccacgggtgccacc
ggcgcgacgggcgccacgggtgcgacgggtgccaccggagccaccggcgcgacgggcgca
acgggcgcgacgggtgcgacgggtgccacgggcgcaacgggtgccaccggagccacgggc
gcgatgggtgcgacgggtgccaccggcgcgacgggtgccacgggcgccacgggtgcgacg
ggtgccaccggcgcgacgggtgccaccggcgcaacgggcgcgatgggtgccacgggcgcg
acgggtgccaccggcgcgacgggtgccacgggcgcaaccggagccaccggagccaccggt
gcgacgggtgccacaggcgccacgggcgcgacgggtgccaccggcgcgacgggtgccacg
ggcgccaccggcgcgatgggtgccaccggcgccacgggtgccaccggcgcgacgggtgcc
accggcgccacgggtgcgacgggtgccaccggcgcgatgggtgccacaggcgccacaggc
gccacgggcgcaaccggagccaccggcgcgacgggtgccacaggcgcgacgggtgccacg
ggtgccacgggcgccacgggtgccacaggcgccaccggcgcgacgggtgccacgggcgcc
acgggcgccacgggtgccaccggcgccacgggtgccacaggcgcaacgggcgcgatgggt
gccacgggcgccacgggcgccacgggtgccaccggcgcgacgggtgccacaggcgcaacg
ggcgcgatgggtgccacgggcgcaaccggagccacaggtgccacgggcgcgacgggtgcc
acaggcgcgacgggtgccacgggtgccacaggtgccacgggcgcaacgggtgccaccggc
gcgacgggtgccacgggcgcgacgggtgccacgggcgcaacgggtgcgacgggtggaaat
ccctgcttcgcagaggggacgcggattgcgactgtgcggggtgacgtgccggtagaggag
ttggtcgcaggcgatgtggtcgtgctgcacgacggcggaacggcgccggtggtgtggctc
ggctatcgcacgatcgacctcgaccgccacgccagacccgaggcggtgcagccgatcgtg
atcgacgccggcgccattgccgacggcatcccggtccgcgacctgatcgtctcgccggat
cacgctttctacctcgacggcgtgctcatcccggcaaaggcgctggttaacggcgcgacg
atccggcagctccggcgcagccaggtcacctacttccatgtcgagctgccgcagcatgcg
gtacttctggcggaaggcatggctgcggagagctacctcgagaccggcaaccgcccggcc
ttcgagaatggcggtgacgcgatcatcctgcatccggacttcgcgcaggccctgcgcgag
accggaagctgcgcgcccttcgccgaggaaggcgcgatcgtggaacgggtccgggcacgc
atcttggcccgggccgggatcgagaccacggacgatgcggatctcaagatccggtatcgg
gccgatggcgcggcggtgatcacctcgcgcacggcgatcccgggctacctgaccccggat
ccgcgtgaccgccgcgtgctcggtgtcaagatcggcgcgatgatgcttggcgacgagccg
atcgcgctcgatcacccggcattgaccgagggctggcatgacgtcgaggccgacggccgc
tggactggcggtgcggcggtggtgccggccagcctgatcaacggccgcacgctcacgatc
accgtggtcggcacgctcgcctacccggcccacggcgcaaaccgcagcgtcgaagccggc
tga

DBGET integrated database retrieval system