KEGG   Acidiphilium multivorum: ACMV_07350Help
Entry
ACMV_07350        CDS       T01446                                 

Gene name
amaB
Definition
(GenBank) N-carbamoyl-L-amino acid hydrolase
  KO
K02083  
allantoate deiminase [EC:3.5.3.9]
Organism
amv  Acidiphilium multivorum
Pathway
Purine metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACMV_07350 (amaB)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.9  allantoate deiminase
     ACMV_07350 (amaB)
Peptidases [BR:amv01002]
 Metallo Peptidases
  Family M20
   ACMV_07350 (amaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(831442..832737)
Genome map
AA seq 431 aa AA seqDB search
MDSLTRAAARLPAWRGEAGARIMARLDALARHSSEADALTRLYLTDAHRDALATLGAWMR
EAGLAVRQDEVGNLIGRREGTAPGLPALLLGSHVDTVRNAGKYDGPLGIVAAIEAVARLN
DTPLPFAIEILALGDEEGVRFPAALTGARAFAGTLDPATLAATDAEGITMRAALEAFGGS
PDRIAAAARHERDVLAYLELHIEQGPVLEAEGLPVGIVTAIAGAERHVIEVTGVAGHAGT
VPMALRHDALAAGAEMVLAAERIARETTDLVATVGQMTALPGAVNVIPSAARFSLDIRSP
SDAVRRDAVARLFMHWREIAARRGVTLSSRKNFEEEAAPCAPALMALLDAAVTRAGVRVR
HLPSGAGHDGLAIASLCPIGMLFLRCRGGISHNPAEAIAEEDAGLAACILADTLRHFDPA
PFASHAQTIKD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttgacacgcgcggccgccagacttcccgcctggcgcggcgaggccggagcc
cggatcatggcgcggctggacgccctggcccggcattcgagcgaggcggacgccctgacc
cgcctctatctgaccgacgcgcatcgcgacgctctcgcgacgctcggcgcctggatgcgc
gaggcaggactcgcggtcaggcaggacgaggtcggcaacctgatcggccggcgcgagggc
acggcacccggcctgccggcgctgttgctgggctcccatgtcgatacggtgcgcaatgcc
gggaaatatgatggcccgctcggtatcgtcgccgcgatcgaggccgtcgcgcggctgaat
gacacgcccctccccttcgccatcgaaatcctcgcgctgggcgacgaggaaggcgtgcgc
tttcccgccgccctgaccggcgcacgcgccttcgccggcacgctcgatccggcgaccctc
gcggcaaccgacgccgaggggatcaccatgcgcgcggcactcgaagcgtttggcggttcg
ccggaccggatcgccgcggcggcgcggcacgagcgcgacgttctggcctatctcgagctg
catatcgagcaagggccggtactggaggccgagggtctgccagtcggcatcgtcaccgcg
atcgccggcgccgaacggcacgtgatcgaggtgacgggcgtggccggccatgccggcacc
gtgccgatggcgctgcgccacgacgcgctggccgcgggcgcggaaatggtgctcgcggcc
gagcggatcgcgcgcgagacgaccgatctcgtcgcgaccgtcggccagatgacggcgctg
ccgggcgcggtgaacgtcatcccctcggcagcacggttcagcctcgacatccgcagcccg
tccgacgcggtgcggcgggatgccgtcgcgcgcctgttcatgcactggcgggagattgcc
gcgcggcgcggcgtcaccctgtccagccgcaagaatttcgaggaagaagcggcgccctgc
gctccagcgctgatggcgctgctcgatgccgccgtcacccgcgccggcgttcgcgtccgc
cacctgccgagcggcgctgggcatgatgggctggccatcgcgtcgctctgccccatcggc
atgctgttcctgcgctgccgcggcggcatcagccacaacccggccgaagcgatcgccgaa
gaggatgcggggcttgcggcctgcatcctcgcggatacgctgcgccacttcgaccccgcc
ccgttcgcctcccatgcccaaacgataaaggactga

DBGET integrated database retrieval system