KEGG   Acidiphilium multivorum: ACMV_07370Help
Entry
ACMV_07370        CDS       T01446                                 

Gene name
glxR
Definition
(GenBank) 2-hydroxy-3-oxopropionate reductase
  KO
K00042  
2-hydroxy-3-oxopropionate reductase [EC:1.1.1.60]
Organism
amv  Acidiphilium multivorum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_07370 (glxR)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.60  2-hydroxy-3-oxopropionate reductase
     ACMV_07370 (glxR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(834062..834940)
Genome map
AA seq 292 aa AA seqDB search
MRVGFIGLGIMGLPMAGHIAAAGHVLFAHSRSGVPPRLLDAGATACASPADVARQADAII
LMLPDTPDVEAVLFGTDGVADGLAAGRMVIDMSSISPLATREFAQRIEAAGCAFVDAPVS
GGEVGAKSASLTIMAGGTDDGFARAEPLLRLMGRTITHVGPCGAGQTAKVANQIIVALTI
EAVAEALVFAARAGADPARVREALMGGFASSRVLEVHGQRMIDRAFEPGFRIGLHQKDLE
LALSGARQLGVSLPNTASCQSLFNACIAAGGRDWDHSALVRALERLAAHELS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcggattcatcgggcttggaatcatggggctgccgatggccgggcacatcgcg
gcggccgggcatgtgctgttcgcccattcgcgcagcggcgtgccccctcgccttctggac
gccggagccaccgcgtgcgcatcccccgccgatgttgcccgccaggcggacgccatcatc
ctcatgctgcccgacacgcccgatgtcgaggcggtcctgttcggcaccgacggtgtcgcc
gacggactcgccgccggccggatggtgatcgacatgagctccatctctccgctcgcgacg
agggagttcgcacaaaggatcgaggctgcgggctgcgcatttgtcgatgcgccggtctcc
ggcggcgaggtcggcgcgaaatcggccagcctgaccatcatggccggcggcaccgatgat
ggcttcgcccgcgcggagccgttgttgcggctgatgggcaggaccatcacccatgtcggc
ccctgcggcgccggccagaccgcgaaggtcgccaaccagatcatcgtcgcgctcaccatc
gaggcggttgccgaggcgctggtcttcgccgcgagggccggcgccgatccggcgcgcgtg
cgcgaggccctgatgggcggcttcgcctcctcgcgcgtgctcgaggtgcacggccagcgc
atgatcgaccgggccttcgaacccggcttccgcattggcctgcaccagaaggacctcgaa
ctcgcgctgtccggcgcgcgccagctgggcgtcagcctgcccaacacggcgtcatgccag
tctctgttcaacgcatgcatcgcggccggtggtcgcgactgggaccattccgccctggtg
cgtgcccttgaacgtctggccgcgcatgagttgagctga

DBGET integrated database retrieval system