KEGG   Acidiphilium multivorum: ACMV_07430Help
Entry
ACMV_07430        CDS       T01446                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase accessory protein
  KO
K07402  
xanthine dehydrogenase accessory factor
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
842705..843577
Genome map
AA seq 290 aa AA seqDB search
MSTVAQPPRGVIVELRRVRGSAPREQGTRMMVTAHATDGTIGGGALEHAAIARAGALLGE
WIAHPDLAREMHELHALGPQLGQCCGGSVTLAYAPSDSGKLEAPPPMFHLQLHGAGHVGR
AVVAVLATLGCTIDWIDSRLDAFPASLPGGKAQLACRRLADPVAAIADAPPGAAFLIMTH
AHPLDAALCAAVMRRGDFGYLGLIGSETKRARFTRQWRRQDIPPAAIARLCCPIGIPAIQ
GKQPELIALAVAAELASRFPARHMRQLPRIPIDLDAECSACRASARCAGS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgttgcacaacctccacgcggcgtgatcgtcgagctgcggcgcgttcgtggc
tcggcgccccgcgagcagggcacgcgcatgatggtgacggcgcacgcgaccgacggcacg
atcggtggcggcgccctggaacacgcggcgatcgcgcgcgccggcgcgctgctcggcgaa
tggatcgcccatcccgatcttgcccgcgaaatgcacgagcttcacgcgctcggcccgcag
cttggccagtgctgcggaggctccgtcaccctcgcctatgcgccgtcggactcgggaaag
ctcgaagccccgccgcccatgtttcatctgcaactgcacggggccggtcatgtcggccgt
gccgtggtcgcggttctcgcgactctcggctgcacgatcgactggatcgactcccgcctc
gacgcatttcccgccagcctccccggtggcaaggcacaactcgcctgccgcaggctggcc
gatccggtcgccgccatcgcggatgcgccgccgggtgccgcgttcctgatcatgacccat
gcccacccgctagacgcggcactgtgcgccgcggtcatgcggcgcggcgatttcggctat
ctcggcctgatcggttcggaaaccaagcgcgcgcgcttcacccgccagtggcgccggcag
gacatcccgcccgcggcgatcgcgcgcctgtgctgcccgatcgggattcccgcgatccag
ggcaagcagccggaactcatcgctctcgccgtcgccgcggaactggcatcgcggtttccg
gcgcggcacatgcgccagcttccgcgcatcccgatcgatctcgacgccgagtgcagcgcc
tgtcgtgcctcggcgcgctgcgccggatcataa

DBGET integrated database retrieval system