KEGG   Acidiphilium multivorum: ACMV_07490Help
Entry
ACMV_07490        CDS       T01446                                 

Gene name
katA
Definition
(GenBank) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
amv  Acidiphilium multivorum
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_07490 (katA)
  Amino acid metabolism
   00380 Tryptophan metabolism
    ACMV_07490 (katA)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     ACMV_07490 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(848527..849966)
Genome map
AA seq 479 aa AA seqDB search
MTDTPFTNATGAPVAENTNVMTAGPRGPVLLQDIWLIEKLAHFDREVIPERRMHAKGWGA
YGSFTVTQDITRYTKAKIFSDIGKRTDIFVRFSSVAGERGAADAERDIRGFSVKFYTEEG
NWDIVGNNTPVFFFRDPLRFPDLNHAIKRDPRTGLRSADNNWDFWTLLPEALHQVTIVMS
ERGIPKSFRHMHGFGSHTFSMINAANERVWVKFHFRSQQGIANLTDAEAEAVVARDRESH
GRDLLAAIEAGNLPRWTLMIQVMTEAQAKVHRHNPFDLTKVWPKAEYPLIEVGVLELDRA
PDNYFAEVEQAAFSPANIVPGISFSPDRMLQARLFSYGDAQRYRLGVNFNQIPVNAPRCP
FRSYHRDGAMRTDGNLGGIVSYHPNTGRIWDDQPAHAEPHVPLEGDAAHHDHRADDDHWE
QPGNLFRLMTPTQRQALFDNTARTLGDASRHIQERHVANCRRADPAYGDGVATALARLS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccccttcaccaacgcgaccggcgcgccggtcgcggagaataccaacgtg
atgacggcaggcccgcgcggcccggtgctgctgcaggatatctggctgatcgagaaactt
gcccatttcgatcgcgaggtgattcccgagcggcggatgcacgcgaaaggatggggcgcc
tacgggagcttcaccgtcacgcaggatatcacacgctataccaaggcgaagatcttttcc
gatatcggcaagaggaccgatatctttgtcagattctcgtcggttgccggtgagcgcggc
gcggcggatgcggaacgcgacatccgcggcttctcggtgaagttctacaccgaagaaggc
aattgggacatcgtcggcaacaacacgccggtgttcttctttcgcgatccgttacggttt
cccgatctcaaccacgcgatcaagcgcgacccgcgcaccggactgcgcagcgccgacaac
aattgggacttctggacccttctgccggaggcgctccaccaggtgaccatcgtgatgtcg
gagcgcggcattccgaaaagcttccgccacatgcacggattcggcagccataccttctcg
atgatcaacgccgcgaatgagcgtgtctgggtgaaattccatttccgcagccagcagggc
atcgccaatctcaccgatgccgaggcggaggcggtcgtcgcgcgcgaccgggaaagccac
ggccgcgacctgcttgccgcgatcgaggccggaaacctcccgcgctggacgctgatgatc
caggtcatgaccgaggcgcaagcgaaggttcatcgccacaatccgttcgatctgaccaag
gtctggccaaaagccgaatatccgctgatcgaggtgggggtgctggaactcgaccgcgcg
cccgacaattacttcgccgaggttgaacaggccgccttctcgcccgccaacatcgtgccc
ggcatctcgttttcacccgaccgcatgctgcaggcgcgcctgttctcgtatggcgatgcg
cagcgctaccggctcggggtcaacttcaaccagattccggtcaatgcgccgcgctgcccg
ttccgcagttatcaccgcgatggcgcgatgcgtaccgacggcaatcttggcggcatcgtc
agctatcatcccaataccggccgcatctgggacgatcagccggctcatgccgaaccgcat
gtcccgttggagggggacgcagcacatcacgatcatcgcgccgacgacgatcactgggag
cagccgggcaacctgttccgcctgatgacgccgacgcaacggcaggctctattcgacaac
accgcccgcacgctcggcgatgcctcgcggcacatccaggagcggcacgtcgccaattgc
cgccgcgccgatccggcctacggcgacggtgtcgcaacagccctcgcccgcctgagctga

DBGET integrated database retrieval system