KEGG   Acidiphilium multivorum: ACMV_07500Help
Entry
ACMV_07500        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(850008..850649)
Genome map
AA seq 213 aa AA seqDB search
MKTTVNGIGIPDTPLANAITELVRDTETPLLFNHSTRVYYWAALAGTRRGLKYDAELLYA
GAMFHDMGLMPSHSSHHERFEVDGANVAKAFLLSRGIAEADVYTVWTAIALHTTPGIPRH
MHPLVALVTAGVEMDVLGLAYDDYADAEREAVVRAYPRTEHFKEDIIDAFYNGIRHKPDT
TFGNVKADVLADKDAHFHRGNFCSVIRGSAWKA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacagtaaacgggatcggtatccccgatacgcccctggccaatgcgataacg
gagctggtgcgcgatacggagacgcctcttctcttcaatcattccacacgggtttattac
tgggccgcgcttgccgggacccggcgggggctgaaatatgatgccgaactgctctatgcc
ggcgcgatgttccacgacatggggctgatgccgagccacagttcgcatcacgagcgcttc
gaggtggacggcgccaatgtcgcgaaagcgtttctgctgagccgcggcattgccgaggcc
gacgtctatacggtctggaccgcgatcgcgctgcacaccacgcccggcattccccggcac
atgcatccgctggtggccctggtcaccgccggcgtggagatggacgtgctcggtctcgcc
tatgacgactatgccgatgccgagcgcgaagccgtggtgcgcgcctatccccgcactgag
catttcaaggaagacatcatcgacgcattctacaacggtatccgccacaagcccgacacc
accttcggcaacgtcaaggccgatgtactcgccgacaaggatgcgcatttccaccgcggc
aatttctgctcggtgatccgcggttccgcatggaaagcctga

DBGET integrated database retrieval system