KEGG   Acidiphilium multivorum: ACMV_07510Help
Entry
ACMV_07510        CDS       T01446                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
850759..851739
Genome map
AA seq 326 aa AA seqDB search
MNDRGIRTILVLAMPGVQLLDVSGPLDVFAEASAQAGRTAYRLEIAGIAPGPIVSSSGAR
LMSDRIVGDGMTGGKIDTLLVAGCPKMPDTAPPQPVLDWLRREARRARRYGSVCSGAFLL
AQAGLLDGKRATTHWAVAARLAAAFPAVTLETDAIHVRDGKLRTAAGVTAGLDLALALVE
EDLGREIAKRVAAQLVMFFKRSGGQLQFSRSGESLPSGRAMLQEVQRYVAANPAADLDVS
SLAARTGLSARHFARLFRSETGMTPASWVESARVTAAREMLESGAAAPKQVAARCGFANV
DTLRRSFQRHVGVTPAAYRRHFGGRA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcgtgggataaggacgatcctggtgctggcgatgccgggcgtgcagttgctc
gacgtctccggaccgctcgacgtcttcgcggaggcaagcgcccaggccgggcggacagcg
tatcggctggagatcgccgggatcgcgccgggccccatcgtcagttcgtcgggcgcgcgc
ctgatgtcggaccgcatcgtcggcgacggcatgacaggcggcaagatcgacacgctgctg
gtcgcgggctgtcccaaaatgcccgacacggcgccgccgcagccggtgctggactggctg
cggcgggaagcgcggcgggcgcggcgctacgggtcggtctgcagcggcgcctttctgctt
gcccaggccggcctgctcgacggcaagcgggcaaccacgcattgggcggtggcggcgcgg
ctcgcggcggcgttccccgcagtcacgctggagaccgatgcgatccatgtgcgcgacggc
aagctgcgcaccgccgccggcgtcaccgccgggctcgatctcgccctcgctctggtcgag
gaggatctcggccgcgagatcgccaagcgggtcgccgcgcaactggtgatgttcttcaag
cggtcgggcgggcagttgcagttcagccgcagcggggagtcgctgccctccggtcgcgcc
atgttgcaggaggtgcagcgatatgtcgcggcaaatcccgccgccgatctcgatgtcagc
agtcttgccgcccgtaccggcctcagcgcccggcacttcgcccggctgttccgcagtgaa
accggaatgaccccggccagctgggtggaatccgcgcgcgtgacggcggcccgggagatg
ctcgaaagtggcgcggccgcgccgaagcaggtcgcggcgcggtgcgggttcgccaatgtc
gatacgctgcgccggtccttccagcgtcatgtgggtgtaacgccggcggcctaccgccgg
cactttggcggaagggcgtaa

DBGET integrated database retrieval system