KEGG   Acidiphilium multivorum: ACMV_07550Help
Entry
ACMV_07550        CDS       T01446                                 

Definition
(GenBank) hypothetical protein
  KO
K10439  
ribose transport system substrate-binding protein
Organism
amv  Acidiphilium multivorum
Pathway
ABC transporters
Bacterial chemotaxis
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ACMV_07550
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ACMV_07550
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    ACMV_07550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
855030..856121
Genome map
AA seq 363 aa AA seqDB search
MRNTIVSAVVAAGILAATGTAAADNLVAPKSLAACFVPQTASTPMVKLKAKHGPYRIAFS
NSYYGNNWRTEMLNIARAYVKQPAVAKYISKFEIQNAGNNVAQQVAQIRQMILGGYNAIV
IDAASPSGLNSVINEAVNHGIVVVAFDNTVTTDKAININEDQAAMGRMWAQFLTKETGGK
GKILMVRGLAGTTVDNDQGDGAMAVFKKSAGLSVKQVYGNWDVGVNQKVTADALSTSHDV
AGVWGTEGATGALQAFLQVKAKLVPMTSESDNGFMKLAVEHHVPALVIGQSPALAAAAIR
AAIAALDGQSLPRTANIPLNPVTTKQMKAGVNYFPKLPNSFVTDIDIPQCGVKIPVGAVV
HGS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaataccatcgtttccgcagtggtcgcggccggcatcctggccgcgacgggcacc
gccgccgccgataaccttgtggcgccgaagagcctcgccgcctgcttcgtcccgcagacg
gcatcgacgccgatggtcaagctgaaggcgaagcacggcccctacaggatcgccttcagc
aactcgtattacggcaacaactggcgcaccgagatgctgaacatcgcccgcgcctacgtg
aagcagccggcggtcgcgaaatacatctcgaagttcgagatccagaatgccggcaacaac
gtcgcccagcaggtcgcgcagatccgccagatgatcctgggcggctacaacgccatcgtc
atcgacgccgcctcgccctccggcctcaacagcgtcatcaacgaggcggtcaatcacggc
atcgtcgtcgtcgccttcgacaatacggtgacgaccgacaaggcgatcaacatcaacgag
gaccaggcggcgatgggccgcatgtgggcgcagttcctcacgaaggaaaccggcggcaag
ggcaagatcctgatggtccgcggcctcgccggcacgacggtcgataacgaccagggcgac
ggcgccatggccgtgttcaagaaatctgcggggctctcggtcaagcaggtctatggcaac
tgggatgtcggggtgaaccagaaggtcaccgccgatgcgctctcgaccagccacgatgtc
gccggcgtctggggcaccgaaggggccaccggcgcgctgcaggccttcctgcaggtgaag
gcgaagctggtgccgatgaccagcgagtcggataacggcttcatgaagctcgcggtcgag
catcacgtcccggcgctggtcatcggccagtcgccggcgctggcggccgcggccatccgc
gcggcgatcgccgccctcgacgggcagagcctgccgcgcaccgcgaacatcccgctcaac
ccggtgacgacgaagcagatgaaggccggcgtcaactacttcccgaaactgccgaacagc
ttcgtcaccgatatcgacatcccgcaatgcggcgtgaagatcccggtcggcgccgtggtc
cacggcagctga

DBGET integrated database retrieval system