KEGG   Acidiphilium multivorum: ACMV_07560Help
Entry
ACMV_07560        CDS       T01446                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K10441  
ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
amv  Acidiphilium multivorum
Pathway
ABC transporters
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ACMV_07560
Enzymes [BR:amv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     ACMV_07560
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    ACMV_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
856147..857721
Genome map
AA seq 524 aa AA seqDB search
MPIAADGARRAGGAGAAAAPTLAATGLSKRFGGVVALRRADLALYPGEVHALLGANGAGK
STLVKLLAGIEQPDDGTIEVGGAAMRFASPHAALAAGIATVHQELSLFPSLSVAENILIG
QEPLRGGHWIDAAAMRERARVLLAMLGATDIDPDATVGDLPLAQAQLVEIAKALSTDPRV
LILDEPTSALSIAEVEHLITVIERLRDRGTAIVLISHRLGEIERLADRVSILRSGEKVGE
FPPGDFSRDRALALMLGEAWQERQTARPAEAFAGRADDTILHVSGLALAPHFADIGFDLR
RGEVLGLAGLEGQGQKEFLFALFGLFRRGLEGVIEIGGRRLLPRRPRDAIAAGIALIPDD
RKTLGGFLGLSIAENIAITVLGSLRRRLLISRRAEADLVDDHIRRLGIKCASRAVPLGSL
SGGNQQKVVVAKWLARREPVYVFCDPTRGVDAGARGELFGVIRELAAQGTAVLFYSTDIS
EFSLLCNRVLVFREGRVAGSLEGASITEQNILDLSFHEAAHEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgccgattgcggctgacggagccaggcgcgcgggcggcgcgggtgctgctgccgcgccg
acgctggcggcaaccggcctgtccaagcgcttcggcggcgtcgtcgcgctgcggcgggcc
gatctcgcgctttatccgggcgaggttcacgccctgctcggcgccaacggcgccggcaag
agcacgctggtcaagctgctcgccggcatcgagcagccggatgacggcaccatcgaggtc
ggcggcgccgccatgcgcttcgccagcccgcacgccgccctcgccgccggcatcgccacc
gtgcaccaggaactctcgctcttcccgagcctgagcgttgccgagaacatcctcatcggc
caggaaccgctgcgcggcgggcactggatcgatgccgcggcaatgcgcgagcgggcgcgc
gtcctgctggcaatgctgggcgcgacggatatcgaccccgacgcgaccgtcggcgatctt
ccgctcgcccaggcgcaactcgtcgaaatcgcgaaggcgctgtcgaccgatccgcgcgtc
ctgatcctcgacgagccgacctccgccctctccatcgccgaggtcgaacacctgataacg
gtcatcgaacggctgcgggaccgtggcacggcgatcgtgctgatctcgcaccggctcggc
gaaatcgaacgcctggccgatcgcgtgtcgatcctgcgcagcggcgagaaggtcggcgag
tttccgcccggcgatttcagccgcgacagggcgctggccctgatgctcggcgaggcctgg
caggagcgccagactgcccggccagcggaagcctttgccggtcgggcggacgacacgatc
cttcacgtcagcggcctcgccctggcgccgcatttcgccgatatcggcttcgacctccgc
cgcggcgaggtgctcggcctcgccggcctcgaagggcaggggcagaaggaattcctgttc
gccctgttcggcctgttccgccgcggactggagggcgttatcgagatcggcggccggcga
ctgctgccgcgccggccccgcgacgccatcgcggcgggcatcgccctgatccccgacgac
cgcaagacgctcggcggcttcctcggcctcagcatcgcggaaaacatcgccatcaccgtg
ctgggttccctgcggcggcgcctcctgatcagccgtcgcgccgaggcggacctggtcgac
gaccatatccgtcgtctcggcatcaaatgcgccagccgcgcggtgccgctcggcagcctg
agcggcgggaaccagcagaaggttgtggtcgccaaatggctggcccggcgcgaacccgtc
tatgtcttctgcgacccgacgcgcggtgtcgatgccggggcgcgcggcgaactcttcggc
gtaatccgcgaactcgccgcccagggcaccgccgtgctgttctattccaccgacatttcg
gagttttcgctgctgtgcaaccgcgttctggtcttccgcgagggccgcgtcgccgggtcg
ctcgaaggagcctccatcacggaacagaacatcctcgacctgtccttccacgaggccgcg
catgaagccgcctga

DBGET integrated database retrieval system