KEGG   Acidiphilium multivorum: ACMV_07580Help
Entry
ACMV_07580        CDS       T01446                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K10440  
ribose transport system permease protein
Organism
amv  Acidiphilium multivorum
Pathway
ABC transporters
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:amv00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ACMV_07580
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    ACMV_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
858709..859695
Genome map
AA seq 328 aa AA seqDB search
MTAPGKTARIGTGPAPFAARLGPAARRMLLSYLILLLVYGCAVAVNPEFLGWGTIRLQLV
QATFIGLIAIGETFAILIGQIDLSVPWTITLSAILSTNLAAVYGHQWIAFAIVIAVGVAV
GLLNTLGVFVLRVHSLIWTLSVNLLLQGIALVYTNAVAPTTHIPGAARALALGNVGFMPA
AFLVWIVCGATSILALRAMPFGRSIYAIGNSPAAALLSGVPIGRVTALIFVISATCAAFV
GLLLSGYSSQAYLGMGNDYLLPPIAAVVIGGTRLSGGEGGYAGSIAGALTVVLLQAILVT
LNISEGARQLVFGAILLALALLFLKRRS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgcccggcaagacggcgcgcatcgggacaggcccggcgccgttcgccgcccgc
ctcgggccggcggcgcggcgcatgctgctgtcctacctgatcctccttctcgtttatggc
tgcgccgtcgcggtgaatcccgaattcctcggctggggcaccatacggctgcaactcgtg
caggcgacgttcatcggcctgatcgcgatcggcgagaccttcgccatcctgatcggccag
atcgacctttcggtgccgtggaccatcaccctctcggccatcctgagcaccaatctcgcg
gcggtgtacggccatcagtggatcgccttcgccatcgtcatcgcggtcggcgtcgcggtg
gggctgctgaacacgctcggcgtgttcgtgctgcgggtgcattcgctgatctggacgctc
agcgtcaacctgctgctccagggcatcgccctcgtctacacgaacgccgtcgcgccgacg
acccatatccccggcgccgcccgcgcgctcgcgctcggcaatgtggggttcatgccggcg
gcgttcctcgtctggatcgtctgcggcgcgacttccatcctggccctgcgggcgatgccg
ttcggccgctcgatctatgcgatcggcaacagcccggcggcagccctgctctccggcgtg
ccgatcggacgggtgacggcactgatcttcgtcatcagcgcgacatgcgccgccttcgtc
gggctgctgctgagcggatattcgtcgcaggcctatctcggcatgggcaacgactatctg
ctcccgccgatcgccgccgtcgtcatcggcggcacccggctgtcaggcggcgaggggggc
tatgccggcagcatcgccggcgcgctgaccgtcgtcctgctgcaggcgatcctggtgacg
ctgaacatttccgaaggcgcgcgccagctcgtcttcggcgccatcctgctggcgctggca
ttgctgttcctcaagcggcggtcatag

DBGET integrated database retrieval system