KEGG   Acidiphilium multivorum: ACMV_07590Help
Entry
ACMV_07590        CDS       T01446                                 

Definition
(GenBank) putative amino acid ABC transporter ATP-binding protein
  KO
K02028  polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
amv  Acidiphilium multivorum
Module
amv_M00236  Putative polar amino acid transport system
Brite
Enzymes [BR:amv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     ACMV_07590
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    ACMV_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_13 RsgA_GTPase AAA_22 AAA_30 NACHT AAA_23 cobW SbcCD_C AAA_19 AAA_28 PduV-EutP AAA_25 AAA_18 AAA_33 ATP-synt_ab AAA_15 oligo_HPY G-alpha AAA_24 IstB_IS21 TsaE NB-ARC Pox_A32
Motif
Other DBs
NCBI-ProteinID: BAJ80106
NITE: ACMV_07590
UniProt: F0J4Q4
Position
complement(859742..860506)
Genome map
AA seq 254 aa AA seqDB search
MQPLLIEAEDVEKRFGNTKVLDRVSFGVRRGETVVLIGSSGSGKTTLLRCINHLEKIEGG
RIVVNGGLIGYREQNGKLAEDLEVNIARQRRDVGMVFQRFNLFANLDVIENIILAPMKVR
GRPRAEAVSRAEALLARVGLSHKARAMPSSLSGGQQQRVAIARALAMQPAVMLFDEPTSA
LDPEMVGEVLAVMRDLAQDGMTMMIVTHEMGFARNVADRIIVMDRGRIVEDGPPAVLFEQ
PVHPKTRALLGCRH
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgctcctgatcgaagccgaggacgtggaaaagcgtttcggcaacacgaaagtt
ctcgaccgtgtcagtttcggcgtccgccgcggcgagaccgttgtcctgatcggttcctcg
ggttcgggcaagaccactctgctgcggtgcatcaaccatctcgagaaaatcgagggcggg
cgcatcgtggtcaatggcggcctgatcggctaccgcgagcagaacggaaaactggcggag
gatctcgaggtcaacatcgcccggcagcgacgggatgtcggcatggtgttccagcgcttc
aacctgttcgcaaatctcgatgtcatcgaaaacatcatcctcgcgcccatgaaagttcgc
ggcaggccgcgagcggaagcggtatcgcgagcggaagcgctgctggcacgcgtcggcctc
tcgcacaaggccagggcgatgccatcctccctctcgggcggacaacagcagcgggtcgcg
atcgcccgtgcgctcgcgatgcagccggcggtgatgctcttcgatgagccgacctcggcg
ctcgaccccgagatggtgggcgaagtgctcgcggtgatgcgcgatctggcgcaggacggc
atgacgatgatgatcgtgacgcatgaaatgggctttgcgcgaaatgtcgcggatcggatc
atcgtgatggatcgcgggcgcatcgtcgaggatgggccgcctgcggtcctgttcgagcag
ccggttcacccgaagacgcgggcgctgctgggttgccggcattag

DBGET integrated database retrieval system