KEGG   Acidiphilium multivorum: ACMV_07590Help
Entry
ACMV_07590        CDS       T01446                                 

Definition
(GenBank) putative amino acid ABC transporter ATP-binding protein
  KO
K02028  
polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
amv  Acidiphilium multivorum
Module
Putative polar amino acid transport system
Brite
Enzymes [BR:amv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     ACMV_07590
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    ACMV_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(859742..860506)
Genome map
AA seq 254 aa AA seqDB search
MQPLLIEAEDVEKRFGNTKVLDRVSFGVRRGETVVLIGSSGSGKTTLLRCINHLEKIEGG
RIVVNGGLIGYREQNGKLAEDLEVNIARQRRDVGMVFQRFNLFANLDVIENIILAPMKVR
GRPRAEAVSRAEALLARVGLSHKARAMPSSLSGGQQQRVAIARALAMQPAVMLFDEPTSA
LDPEMVGEVLAVMRDLAQDGMTMMIVTHEMGFARNVADRIIVMDRGRIVEDGPPAVLFEQ
PVHPKTRALLGCRH
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgctcctgatcgaagccgaggacgtggaaaagcgtttcggcaacacgaaagtt
ctcgaccgtgtcagtttcggcgtccgccgcggcgagaccgttgtcctgatcggttcctcg
ggttcgggcaagaccactctgctgcggtgcatcaaccatctcgagaaaatcgagggcggg
cgcatcgtggtcaatggcggcctgatcggctaccgcgagcagaacggaaaactggcggag
gatctcgaggtcaacatcgcccggcagcgacgggatgtcggcatggtgttccagcgcttc
aacctgttcgcaaatctcgatgtcatcgaaaacatcatcctcgcgcccatgaaagttcgc
ggcaggccgcgagcggaagcggtatcgcgagcggaagcgctgctggcacgcgtcggcctc
tcgcacaaggccagggcgatgccatcctccctctcgggcggacaacagcagcgggtcgcg
atcgcccgtgcgctcgcgatgcagccggcggtgatgctcttcgatgagccgacctcggcg
ctcgaccccgagatggtgggcgaagtgctcgcggtgatgcgcgatctggcgcaggacggc
atgacgatgatgatcgtgacgcatgaaatgggctttgcgcgaaatgtcgcggatcggatc
atcgtgatggatcgcgggcgcatcgtcgaggatgggccgcctgcggtcctgttcgagcag
ccggttcacccgaagacgcgggcgctgctgggttgccggcattag

DBGET integrated database retrieval system