KEGG   Acidiphilium multivorum: ACMV_07600Help
Entry
ACMV_07600        CDS       T01446                                 

Definition
(GenBank) putative amino acid ABC transporter permease protein
  KO
K02029  
polar amino acid transport system permease protein
Organism
amv  Acidiphilium multivorum
Module
Putative polar amino acid transport system
Brite
Transporters [BR:amv02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    ACMV_07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(860506..861258)
Genome map
AA seq 250 aa AA seqDB search
MHFDWPYFWHQLLEPNGAFLEGLWLTIMISVGGQAIGLAIGLPAALARRSKMGVLRWPAR
AYIFLMRGTPLLVQIVFIYTGLAAAGILRFHDIHLGGLTLAGNVQAGILALGLNEGAYMA
EIFRAGIDAVDRGQTEAAKSLGMVPWQILRYVVLPQALRVVLLPIGNQFNIMLKNSTLVS
VIGVSEMLLVTETINSATFRTFELYSVLALYFLALTTIWGAVMAQVERRMDRQPDDSAID
AISQPMTETA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcatttcgactggccttatttctggcatcagctgctggagccgaacggcgccttcctt
gaggggctctggctgacgatcatgatcagcgtcggggggcaggcgatcgggctcgcgatc
ggtctgcccgcagcgctcgcaaggcggtcgaagatgggcgtcctgcgttggccggcgcgg
gcctatatcttcctgatgcgcggcacgcctctgctggtgcagatcgtcttcatctatacc
ggactcgcggccgccggcattctccggttccatgacatccatctcggcggactcaccctc
gcgggcaatgtgcaggccggcatcctcgcgctgggcctgaacgaaggggcgtacatggcc
gaaatattcagggccggcatcgatgccgtcgatcgcggccagaccgaggcggcgaaatcg
ctcggcatggttccctggcagatccttcgatatgtcgtgctgccccaggcgctacgtgtg
gttttgttgccgatcggcaatcagttcaacatcatgctgaagaactcgacgctggtgagc
gtgatcggcgtttcggaaatgctgctggtcaccgagacgatcaattcggccacgttccgc
accttcgaactctactcggtgcttgccctctattttctcgcgttgaccacgatatggggt
gccgtgatggcgcaggtcgagcgccggatggacaggcagcccgacgacagcgccatcgac
gccatcagccagccgatgacggaaaccgcctga

DBGET integrated database retrieval system