KEGG   Acidiphilium multivorum: ACMV_07640Help
Entry
ACMV_07640        CDS       T01446                                 

Definition
(GenBank) cation efflux protein
  KO
K16264  
cobalt-zinc-cadmium efflux system protein
Organism
amv  Acidiphilium multivorum
Brite
Transporters [BR:amv02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ACMV_07640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(865836..866810)
Genome map
AA seq 324 aa AA seqDB search
MPHDHHAHDAHAGHDHHGHSHGPGHSHAPADFGAAFAIGAILNSAFVVGEVIAGIAAHSM
ALVADAGHNLGDVLGLLVAWVAAVLAKRSPSRRYTYGLGRGTILAALMNATILLISIGAI
AVEAIRRLFEPAPVGTATIMIVAAIGIVVNGVTAWLFAAGRGSDINIRAAFQHMAYDALV
SLGVVVAGAVILLTGWERIDPLASLAIAGVILAGTWGLLRDSVALAMDRVPDGIDIAALR
DFVLDWPEVSAVHDLHVWPTSTTDSAMTLHVVTPGGHPGDDFTGRLAEAIRLNFGIGHLT
LQIETDAALCATDCSRHHLPAARS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacgatcatcatgctcatgacgcccatgccggccatgaccatcacggccattcc
cacggccccgggcacagccatgcgccggcggatttcggggcggcgttcgcgatcggggcg
atcctgaattccgcgttcgtcgtcggcgaggtgatcgccggcatcgcggcgcattcgatg
gcgctggtcgccgatgccggccacaatctcggcgacgtgctgggcctgctcgtggcctgg
gtggcggcggttctggcgaagcggtccccttcccggcgctatacctatggcctcgggcgc
ggcaccattctcgccgcgctgatgaatgcgacgatcctgctcatctccatcggcgccatc
gccgtcgaggccatccgtcggctgttcgagcccgccccggtcggcacggcgacgatcatg
atcgtcgcggcgatcggcatcgtcgtcaacggcgtcaccgcctggctgttcgccgcgggg
cgcgggtccgacatcaatatccgcgccgcgttccagcacatggcctatgacgcgctcgtc
tcgctcggcgtcgtcgtggccggcgccgtgatcctgctgaccggatgggagcgcatcgat
ccgctggcgagcctcgccatcgccggcgtcatcctggccggcacctgggggctgctcagg
gattcggtcgcccttgccatggaccgcgtgccggacggcatcgatatcgccgcgctgcgc
gatttcgtcctggactggccggaagtatcggcggtgcatgatctgcatgtgtggccgacg
agcaccacggacagcgccatgaccctgcatgtcgtgacgcccggcggccaccccggggat
gatttcaccggccgcctcgcggaggcgatacggctgaatttcgggatcggccacctcacc
ctgcagatcgagaccgatgccgcgctgtgcgcgacggactgttcgcggcatcatctcccc
gcggcgcggtcctga

DBGET integrated database retrieval system