KEGG   Acidiphilium multivorum: ACMV_08580Help
Entry
ACMV_08580        CDS       T01446                                 

Gene name
mro
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
amv  Acidiphilium multivorum
Pathway
amv00010  Glycolysis / Gluconeogenesis
amv00052  Galactose metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACMV_08580 (mro)
   00052 Galactose metabolism
    ACMV_08580 (mro)
Enzymes [BR:amv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ACMV_08580 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAJ80205
NITE: ACMV_08580
UniProt: F0J5F6
Position
complement(976557..977582)
Genome map
AA seq 341 aa AA seqDB search
MPEPVIAPYGTTRAGAKVRRITLANAAGMSVSLLDYGGIVDELLAPDRRGRLANVVLSCP
TLADYETKSPYFGALVGRYANRIAGAAFTLDGVRHTLPANEGANTLHGGPADGPAPNFSH
RVWDIVAATGSALTLRLHSPDGENGFPGDLTVYVTYTLTPDNTLRLDYAARVAGRATVLN
LTNHAYFNLAGGGTALDHEIAVAAARYLAPDAANIPTGAIAPVAGTWLDLTRQQRIGPAR
AGLDHCFVLDKPEGVIGPAALLRDPASGRVLAVETTEPAVQVYAAGKLDLPPYGPGDGIA
LETQHFPDSPNRPAFPSTRLDPGEAFRSSTVWRFTTDQTRT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacccgtcatcgccccctacggcaccacgcgcgccggcgcgaaggtgcggcgg
atcaccctcgcgaacgcggccggcatgtcggtcagcctgctcgactatggcggcatcgtc
gacgaactcctcgcccccgaccgccgcggccgcctcgccaatgtcgtgctgagctgcccc
accctcgccgactacgagacgaaaagcccctatttcggcgcgctcgtcggccgctacgcc
aaccgcatcgccggcgccgccttcaccctcgacggcgtccgccacaccctgccggccaac
gagggcgccaacaccctgcatggcggcccggccgacggccccgcgcccaatttcagccac
cgcgtgtgggacatcgtcgccgccaccggcagcgccctcaccctccgcctgcacagtccg
gacggcgagaacggcttccccggcgacctcaccgtctacgtcacctacacgctgacgccg
gacaacacgctccgcctcgactatgccgcccgcgtcgccggccgcgccacggtgctcaac
ctgaccaaccacgcctatttcaacctcgccggcggcggcacggcgctcgaccacgaaatc
gccgtcgccgccgcgcgctacctcgcgcccgatgcggcgaacatcccgaccggcgccatc
gcccccgtcgccggcacctggctcgacctcacccgccagcagcgaatcggccccgcccgc
gccggcctcgaccactgcttcgtgctcgacaagcccgaaggcgtcatcggccccgccgcc
ctcctgcgcgaccccgcctccggccgcgtcctcgccgtcgagaccaccgagcccgccgtg
caggtctacgccgccggcaagctcgacctgccgccctacggccccggcgacggaatcgcc
ctcgaaacccagcatttccccgattcgccgaaccgccccgcctttccctccaccaggctc
gaccccggcgaggccttccgttccagcaccgtctggcgcttcaccaccgaccagacgaga
acatga

DBGET integrated database retrieval system