KEGG   Acidiphilium multivorum: ACMV_08650Help
Entry
ACMV_08650        CDS       T01446                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amv  Acidiphilium multivorum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACMV_08650
   00052 Galactose metabolism
    ACMV_08650
   00500 Starch and sucrose metabolism
    ACMV_08650
   00520 Amino sugar and nucleotide sugar metabolism
    ACMV_08650
Enzymes [BR:amv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACMV_08650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
987410..988198
Genome map
AA seq 262 aa AA seqDB search
MLPVVDKPLIQYAIDEARAAGIEQFCMVTGRGKTALIDHFDIAFELEATLAERGKQDALD
MLHEEVMEPGSIVTVRQQVPLGLGHAIWCARAFIGDDPFAILLPDDLVLSQTPCLGQLAD
AYRATGGNVVAVEEVPMEQVHRYGVLKTGATERNLVEVKGLVEKPKREEAPSNLSIIGRY
VLLPEVIGHLARMERGAGNEVQLTDAMAKMIGAAPFHGLKFEGRRFDCGDKAGYLEAQIA
FGLVRPDLGPSIRHFLKAYSDA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccgtcgtcgacaagccgctgatccagtacgcgatcgacgaggcgcgggcggcc
gggatcgagcagttctgcatggtcaccgggcgcggcaagacggcgctgatcgaccatttc
gacatcgccttcgagctggaggcgacgctggccgagcgcggcaagcaggacgcgctcgac
atgctgcacgaggaggtgatggagccgggctcgatcgtgacggtgcgccagcaggtgccg
ctcgggcttggccacgcgatctggtgcgcgcgggccttcatcggcgacgatccgttcgcc
atcctgctgccggacgacctggtgctgagccagaccccctgcctcggccagctcgccgac
gcctaccgggcgaccgggggcaatgtcgtcgccgtcgaggaggtgccgatggagcaggtg
caccgctacggcgtgctcaagaccggggcgacggagcggaatctcgtggaggtgaagggg
ctggtcgagaagccgaaacgcgaggaggcgccgtcgaatctctcgatcatcgggcgctac
gtgctgctgccggaggtgatcggccatctggcgcggatggagcgcggcgccggcaacgag
gtgcagctgaccgacgcgatggcgaagatgatcggggcggcgccgttccacgggctgaaa
ttcgaggggcggcggttcgactgcggcgacaaggcgggctatctggaagcgcagattgcc
ttcggtctggtgcgtccggacctggggccgtcgatccgtcacttcctgaaggcttattcc
gatgcatga

DBGET integrated database retrieval system