KEGG   Acidiphilium multivorum: ACMV_08650Help
Entry
ACMV_08650        CDS       T01446                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amv  Acidiphilium multivorum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACMV_08650
   00052 Galactose metabolism
    ACMV_08650
   00500 Starch and sucrose metabolism
    ACMV_08650
   00520 Amino sugar and nucleotide sugar metabolism
    ACMV_08650
Enzymes [BR:amv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACMV_08650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
987410..988198
Genome map
AA seq 262 aa AA seqDB search
MLPVVDKPLIQYAIDEARAAGIEQFCMVTGRGKTALIDHFDIAFELEATLAERGKQDALD
MLHEEVMEPGSIVTVRQQVPLGLGHAIWCARAFIGDDPFAILLPDDLVLSQTPCLGQLAD
AYRATGGNVVAVEEVPMEQVHRYGVLKTGATERNLVEVKGLVEKPKREEAPSNLSIIGRY
VLLPEVIGHLARMERGAGNEVQLTDAMAKMIGAAPFHGLKFEGRRFDCGDKAGYLEAQIA
FGLVRPDLGPSIRHFLKAYSDA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccgtcgtcgacaagccgctgatccagtacgcgatcgacgaggcgcgggcggcc
gggatcgagcagttctgcatggtcaccgggcgcggcaagacggcgctgatcgaccatttc
gacatcgccttcgagctggaggcgacgctggccgagcgcggcaagcaggacgcgctcgac
atgctgcacgaggaggtgatggagccgggctcgatcgtgacggtgcgccagcaggtgccg
ctcgggcttggccacgcgatctggtgcgcgcgggccttcatcggcgacgatccgttcgcc
atcctgctgccggacgacctggtgctgagccagaccccctgcctcggccagctcgccgac
gcctaccgggcgaccgggggcaatgtcgtcgccgtcgaggaggtgccgatggagcaggtg
caccgctacggcgtgctcaagaccggggcgacggagcggaatctcgtggaggtgaagggg
ctggtcgagaagccgaaacgcgaggaggcgccgtcgaatctctcgatcatcgggcgctac
gtgctgctgccggaggtgatcggccatctggcgcggatggagcgcggcgccggcaacgag
gtgcagctgaccgacgcgatggcgaagatgatcggggcggcgccgttccacgggctgaaa
ttcgaggggcggcggttcgactgcggcgacaaggcgggctatctggaagcgcagattgcc
ttcggtctggtgcgtccggacctggggccgtcgatccgtcacttcctgaaggcttattcc
gatgcatga

DBGET integrated database retrieval system