KEGG   Acidiphilium multivorum: ACMV_10970Help
Entry
ACMV_10970        CDS       T01446                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amv  Acidiphilium multivorum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1239818..1240654)
Genome map
AA seq 278 aa AA seqDB search
MTDVAASGWAGFDLARPLVMGILNATPDSFSGGGATQGPSALIETGLAMRAAGAAIIDVG
GESTRPGAAVVPPDIEIARIVPVIGGLARDGATVSVDTRNAATMRAALDAGARIVNDVSG
LRHDPAAAPLVAAAACPVILMHMRGTPATMSAQAVYNDVVADVLAELAATRDAALAAGIA
PAAIALDPGFGFTKRGAQNVALLRALPSFRALGHPVLAGVSRKRFIGELAGEPDPARRDP
GSIAAALFAAGRGAAIIRVHDVPGTVQALRVWQALADA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtcgccgcatccggctgggcggggttcgacctcgcccggcccctcgtcatg
ggcatcctgaacgccacgcccgacagtttttcgggcggcggcgcgacgcaaggcccctcg
gccctgatcgaaaccgggctcgccatgcgcgcggccggcgccgcgatcatcgatgtcggc
ggcgaaagcacccgccccggcgccgccgtggtgccgcccgacatcgagatcgcccgcatt
gtgccggtcatcggcggcctcgcccgggacggcgcgaccgtctcggtcgacacgcggaac
gccgccaccatgcgcgccgccctcgatgccggggcgcgcatcgtcaacgacgtctccggc
ctccgccacgatcccgccgccgcgccgctggtcgccgccgccgcctgccccgtcatcctg
atgcacatgcgcggcaccccggcgacgatgagcgcgcaggcggtctataacgatgtcgtc
gccgatgtcctcgccgaactcgcggccacccgcgacgccgcccttgccgccggcatcgcg
cccgccgccatcgcgctcgatcccggtttcggcttcaccaagcgcggcgcgcagaacgtg
gcgctgctgcgcgccctgccatccttccgcgcgctcggccatccggtcctcgccggcgtc
tcgcgcaagcgcttcatcggcgaactcgccggcgagcccgaccccgcccgccgcgatccc
ggctccatcgccgccgccctgttcgcggcggggcggggggcggcgatcatccgcgtccac
gacgtgcccggcacggtgcaggcgctgcgcgtctggcaggccctcgccgatgcctga

DBGET integrated database retrieval system