KEGG   Acidiphilium multivorum: ACMV_12730Help
Entry
ACMV_12730        CDS       T01446                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
amv  Acidiphilium multivorum
Pathway
amv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01130  Biosynthesis of antibiotics
amv01230  Biosynthesis of amino acids
Module
amv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACMV_12730 (trpC)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ACMV_12730 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAJ80620
NITE: ACMV_12730
UniProt: F0IXW0
Position
complement(1436461..1437273)
Genome map
AA seq 270 aa AA seqDB search
MNDKIEHDVLKTICADKLAEVEAAKAETGLEEMRARAKDTPPPRGFARALMDAAASGRTG
LIAEIKKASPSAGLIRADFNPATIARAYQEGGAVCLSVLTDRKYFQGQPAHLQAAREAVD
LPVLRKDFILDEWQIYESRAMGADCILLIMAALGDEQARAFEELASALDMSVLVEVHDEA
ELDRALGLQARLIGINNRNLKTMQTDIAVSERLAGQIPPERFVVAESGIRDYDDIKRLKA
VGVQGILVGESLMRQDDIVAATRRLLGLGA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaagatcgaacacgacgtgctgaagacgatctgcgccgacaagctggccgag
gtggaggcggcgaaggcggagaccgggctggaggagatgcgcgcacgggcgaaggacacg
ccgccgccgcgcggcttcgcccgcgcgctgatggacgccgccgcctccgggcggaccggg
ctgatcgccgagatcaagaaggcgtcaccctcggccgggctgatccgcgccgatttcaac
ccggcgacgatcgcccgcgcctatcaggagggcggggcggtgtgcctttcggtgctgacc
gaccggaaatatttccagggccagcccgcgcacctgcaggcggcgcgcgaggcggtggac
ctgccggtgctgcgcaaggatttcatcctcgacgagtggcagatctacgaaagccgcgcg
atgggggcggactgcatcctgctgatcatggcggcgctgggcgacgagcaggcgcgggcc
ttcgaggagctggcgagcgcgctcgacatgagcgtgctggtcgaggtgcatgacgaggcg
gaactcgaccgcgcgctcgggctgcaggcccggctgatcggcatcaacaaccgcaatctc
aagacgatgcagaccgatatcgcggtctccgagcggctcgccgggcagattccgccggag
cgtttcgtggtcgcggaaagcggcatccgcgactatgacgacatcaagcggctgaaggcg
gtgggggtgcagggcatcctggtcggcgagagcctgatgcggcaggacgacatcgtcgcc
gcgacgcgccggctgctcgggctcggggcatga

DBGET integrated database retrieval system