KEGG   Acidiphilium multivorum: ACMV_12770Help
Entry
ACMV_12770        CDS       T01446                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACMV_12770 (tpiA)
   01230 Biosynthesis of amino acids
    ACMV_12770 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACMV_12770 (tpiA)
   00051 Fructose and mannose metabolism
    ACMV_12770 (tpiA)
   00562 Inositol phosphate metabolism
    ACMV_12770 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_12770 (tpiA)
Enzymes [BR:amv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACMV_12770 (tpiA)
Exosome [BR:amv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACMV_12770 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACMV_12770 (tpiA)
  Exosomal proteins of melanoma cells
   ACMV_12770 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1442432..1443193
Genome map
AA seq 253 aa AA seqDB search
MPQLIAGNWKMNGTLAGIAAYAAALRPASPGAELLVCPPAPLIAPLRAALDGAPVALGAQ
DCAVKRSGAHTGDLSADLLAELGATHVILGHSERRADHAESSATVREKARTAIAAGLVPI
ICVGETEAERDSGEAETVVRAQLAGSLPEELAGQTVPGVVAPGIIAYEPVWAIGTGRTPT
EEDVAAMHASIRAALRRQLGAAGATMPILYGGSVKPSNAASLLALPEVGGALVGGASLKA
EDFLAIASAAARD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctgatcgccggaaactggaagatgaacggcaccctcgccggcattgccgcc
tatgccgccgccctgcgtcccgcctccccgggcgcggagctgctggtctgcccgccggcg
ccgctgatcgccccgctgcgcgccgccctcgacggcgccccggtcgccctcggcgcgcag
gactgcgcggtgaagcgctccggcgcgcataccggcgacctctcggccgacctgctggcc
gagctcggcgccacccatgtcatcctcggccattccgagcgccgcgccgatcacgccgaa
tcctccgcgaccgtgcgcgagaaggcgcgcaccgcgatcgccgccggcctggtcccgatc
atctgcgtcggcgaaaccgaggccgagcgcgattccggcgaggccgaaaccgtggtccgc
gcccagctcgccggcagcctgccggaggagctggccggccagaccgtccccggcgtcgtc
gcccccggcatcatcgcctacgagccggtctgggcgatcggcaccggccgcacccccacc
gaggaggacgtcgcggcgatgcacgcctcgatccgcgccgccctgcgccgccagctcggc
gccgccggcgcgacgatgccgatcctttacggcggctcggtcaagccctcgaacgccgcg
tccctgctcgccctgcccgaggtcggcggcgccctggtcggcggcgccagcctcaaggca
gaggacttcctggcgattgcctccgccgcggcgcgggactag

DBGET integrated database retrieval system