KEGG   Acidiphilium multivorum: ACMV_12840Help
Entry
ACMV_12840        CDS       T01446                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
amv  Acidiphilium multivorum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACMV_12840 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACMV_12840 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_12840 (glcB)
Enzymes [BR:amv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ACMV_12840 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1448299..1450467
Genome map
AA seq 722 aa AA seqDB search
MSQTYVDAAGLRVAAELHQFIETEALPGTGIESGAFWQGFAGLIARHAPRNAELLAERDR
LQAAIDDWHRSRRGQPVDPAAYEAFLREIGYLRPEPGDVKVTSERVDPEIAAIAGPQLVV
PVMNARYALNAANARWGSLYDALYGTDAIPESGGLERGKAYNPQRGAAVVARGRAFLDDH
FPLATGSHADVRAWRVHNGHLAAVLESGETGLKHAAQFAGYRGEPAAPTAVLLRHHNLHV
EIAIDPTSPIGRTDKAGVADLIVESAISTIMDAEDSVAAVDAEDKVLVYRNWLGLMAGTL
SEQVEKGGKTFTRALNPDRAYTAPDGSTLTLPGRVLMLVRNVGHHIYTDTVLDAAGKPIP
ETILDLVVTSLCGLHDIRRTAGLRNSRAGSVYIVKPKMHGADEVAYANGLFAATESLLGL
APDTLKMGIMDEERRTSANLKACIAAAASRIFFINTGFLDRTGDEIHTSIEAGPMIRKNE
IRNTPWIKAYEDRNVDIGIVCGLPGHAQIGKGMWAAPDAMAAMLEQKVGHPRAGANTAWV
PSPTAATLHALHYHMVDVAARQAELAARPMGSLADLLTIPLADRPNWRPEDIQQELDNNA
QGILGYVVRWIDQGIGCSKVPDIHNVALMEDRATLRISAQHIANWLHHGIVSEAQVMETM
KRMAAVVDGQNAGDPAYRNMAPGFDGVAFQAACDLVFKGRTQPNGYTEFILHDRRREAKA
SA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacctatgtggacgcggcgggcctgcgcgtcgccgccgagcttcaccagttc
atcgagaccgaggcgctgcccggcaccgggatcgagtccggcgccttctggcagggtttc
gccggcctcatcgcccgtcacgccccccgcaacgccgagctcctcgccgagcgcgaccgt
ctccaggccgcgatcgacgactggcaccgctcccgccgcggccagccggtcgaccccgcc
gcctacgaggccttcctgcgcgagatcggctacctcaggcccgagcccggcgacgtgaag
gtcacctccgagcgcgtcgatcccgaaatcgccgccatcgccggcccgcagctcgtcgtg
ccggtgatgaacgcccgctacgcgctgaacgccgccaatgcccgctggggcagcctctac
gacgcgctctacggcaccgacgcgattccggagtccggcggcctcgagcgcggcaaggcc
tacaacccgcagcgcggcgccgccgtcgtcgcccgcggccgcgccttcctcgacgatcat
ttcccgctcgccaccggcagccacgccgatgtccgcgcctggcgcgtgcataacggccat
ctcgccgccgtgctcgaaagcggcgagaccggcctgaagcacgccgcccagtttgccggc
tatcgcggcgagcccgccgcccccaccgccgtcctgctccgccaccacaacctgcatgtc
gagatcgcgatcgacccgaccagcccgatcggccgcaccgacaaggccggcgtcgccgac
ctcatcgtcgaatccgcgatcagcacgatcatggacgccgaggacagcgtcgccgccgtc
gatgccgaggacaaggtgctggtctaccgcaactggctcggcctgatggccggcacgctc
agcgaacaggtcgagaagggcggcaagaccttcacccgcgccctcaaccccgaccgcgcc
tacaccgcgccggacggctcgaccctcaccctccccggccgcgtgctgatgctggtccgc
aatgtcggccaccacatctataccgacaccgtgctcgacgccgccggcaagccgatcccc
gagacgatcctcgacctcgtggtcacctccctctgcggcctgcacgacatccgccgcacc
gccggcctgcgcaactcccgcgccggctcggtctacatcgtcaagccgaagatgcacggc
gccgacgaggtcgcctacgccaacggcctcttcgccgcgaccgaatccctgctcggcctc
gcgccggacacgctgaagatgggcatcatggacgaggagcgccgcacctcggccaatctc
aaggcctgcatcgccgccgccgccagccgcatcttcttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctcgatcgaggccggcccgatgatccgcaagaacgag
atcaggaacacgccctggatcaaggcctatgaggaccgcaacgtcgatatcggcatcgtc
tgcggcctgcccggccacgcccagatcggcaagggcatgtgggccgcgcccgacgcgatg
gcggcgatgctcgaacagaaggtcggccacccccgcgccggcgccaacaccgcctgggtg
ccctcgcccaccgcggccacgctgcacgccctgcactaccacatggtcgatgtcgccgcc
cgccaggccgagctcgccgcccgcccgatgggctccctcgccgacctgctgaccatcccg
ctggccgatcgcccgaactggcggccggaggacatccagcaggagctcgacaacaacgcc
cagggcatcctcggctatgtcgtccgctggatcgaccagggcatcggctgctccaaggtg
ccggacatccacaacgtcgcgctgatggaagaccgcgccacccttcgcatctccgcccag
cacatcgccaactggctgcaccacggcatcgtctccgaggcgcaggtgatggagacgatg
aagcgcatggccgcggtggtcgatggccagaacgccggcgacccggcctaccgcaacatg
gccccgggcttcgacggcgtcgccttccaggcggcgtgcgacctcgtcttcaagggccgc
acccagccgaacggctacaccgagttcatcctgcacgaccgccggcgcgaggccaaagcc
tccgcctga

DBGET integrated database retrieval system