KEGG   Acidiphilium multivorum: ACMV_13740Help
Entry
ACMV_13740        CDS       T01446                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amv  Acidiphilium multivorum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACMV_13740 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACMV_13740 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACMV_13740 (trpB)
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACMV_13740 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1554667..1555881
Genome map
AA seq 404 aa AA seqDB search
MNKPIPNSLRTLPDDRGRFGEFGGRFVAETLMPLILELEAAYEAAKDDPDFMREFQYYLQ
HYVGRPSPLWFAERLTKELGGAKVYFKRDELNHTGAHKINNCIGQILLAKRMGKTRIIAE
TGAGQHGVATATVAALFGLPCIVYMGATDVERQQPNVFRMKLLGAEVRPVTSGASTLKDA
MNEALRDWVANVRDTFYIIGTAAGPHPYPAMVRDFQSVIGVEARAQMMEAEGRLPDVAIA
AIGGGSNAIGLFHAFLDEQVKLIGVEAAGRGLDSGEHAASLSRGRPGVLHGNRTYLLQDD
DGQILEAHSISAGLDYPGIGPEHSYLHDIGRVEYVSATDDEALAAFQLCCRTEGIIPALE
PSHALAHVAKIAPGMDKESIILMNLCGRGDKDIFTVARHLGEQI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccgatacccaattccctgcgcaccctgcccgacgaccgcggccgcttcggc
gagttcggcggcaggttcgtcgccgaaaccctgatgccgctgatcctcgagctcgaggcg
gcctacgaggcggcgaaggacgatcccgatttcatgcgggaattccagtattacctgcaa
cattatgtcggccgccccagcccgctctggttcgccgagcggctgacgaaggaactcggc
ggcgccaaggtctatttcaagcgcgacgagctgaaccacaccggcgcgcacaagatcaac
aactgcatcggccagatcctgctcgccaagcgcatgggcaagacgcgcatcatcgccgag
accggcgccggccagcacggcgtcgccaccgcgacagtggccgccctcttcggcctgccc
tgcatcgtctacatgggcgccaccgatgtcgagcggcagcagcccaacgtcttccgcatg
aagctgctcggcgccgaggtccgccccgtgacctccggcgcgtcgacgctgaaggacgcg
atgaacgaggcgctgcgcgactgggtcgcgaatgtgcgcgacaccttctacatcatcggc
accgccgccggcccgcacccctatcccgccatggtgcgggacttccagtcggtcatcggg
gtcgaggcccgcgcccagatgatggaggccgagggccgcctgccggatgtcgcgatcgcg
gcgatcggcggcggctccaacgccatcggcctgttccacgccttcctcgacgagcaggtg
aagctgatcggcgtcgaggccgccggccgcggcctcgattcgggcgagcacgccgcctcc
ctctcgcgcggccgccccggcgtgctgcacggcaaccgcacctacctgctgcaggacgat
gacggccagatcctcgaggcccactcgatctccgccgggctcgactatccgggcatcggc
cccgagcattcctacctgcacgatatcggccgcgtggaatacgtgtccgcgaccgacgac
gaggccctcgccgccttccagctctgctgccgcaccgaggggatcatccccgccctcgag
ccctcgcacgccctcgcccatgtcgcgaagatcgcccccggcatggacaaggagagcatc
atcctgatgaatctctgcggccgcggcgacaaggacatcttcaccgtcgcccgccatctc
ggagaacagatttga

DBGET integrated database retrieval system