KEGG   Acidiphilium multivorum: ACMV_13750Help
Entry
ACMV_13750        CDS       T01446                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amv  Acidiphilium multivorum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACMV_13750 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACMV_13750 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACMV_13750 (trpA)
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACMV_13750 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
1555878..1556708
Genome map
AA seq 276 aa AA seqDB search
MSRIAATFARLRDEGRAGLIPFVEAFDPDRETSATLLAGMAARGADLIEIGMPFTDPMAD
GPTIQQAGRRALRAGATLAGTLGLVRDFRAVNDTVPLILMGYLNPILSYGVERFTADAAA
AGVDGVIVVDLPTEEADLLLPHLRQHRIDLIRLVAPTTTDERLPVVLNDSSGFVYYVSIT
GITGTRTASAEDLARDIPRVRKATDMPIAVGFGVRTPAQAATVARFADAAVVASALIDKL
AAGLDADGKAPPAIVEAVLDDVAALAAAVRGERRAA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgcatcgccgccaccttcgcccgcctccgcgatgagggccgggcgggcctgatc
cccttcgtcgaggcgttcgaccccgatcgcgaaacctccgccaccctgctcgccggcatg
gccgcccgcggcgccgacctgatcgagatcggcatgcccttcaccgacccgatggcggac
ggcccgaccatccagcaggccggccgccgggcgctgcgcgccggtgcgaccctcgccggc
acgctcggcctggtgcgcgacttccgcgctgtcaacgacaccgtgccgctgatcctgatg
ggctatctcaaccccatcctctcctacggcgtcgagcgcttcaccgccgatgccgccgcc
gccggcgtcgatggcgtcatcgtcgtcgacctgccgaccgaggaggccgacctgctgctg
ccgcatctgcgccagcaccgcatcgacctcatccgcctcgtcgcccccaccacgacggac
gagcgcctgcccgtcgtgctcaacgactcctccggcttcgtctattacgtctcgatcacc
ggcatcaccggcacccgcaccgcctccgccgaggatctcgcgcgcgacatcccccgcgtc
cgcaaggcgacggacatgccgatcgccgtcggcttcggcgtccgcacccccgcccaggcc
gcaacggtggcgcggttcgccgatgccgccgtggtcgcctcggcgctgatcgacaagctc
gccgccggcctcgatgccgacggcaaggccccgcccgccatcgtcgaggcggtgctggac
gatgtcgccgccctggccgcggcggtgcgcggcgagcgccgcgccgcctga

DBGET integrated database retrieval system