KEGG   Acidiphilium multivorum: ACMV_14970Help
Entry
ACMV_14970        CDS       T01446                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amv  Acidiphilium multivorum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACMV_14970
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACMV_14970
   00650 Butanoate metabolism
    ACMV_14970
  Lipid metabolism
   00071 Fatty acid degradation
    ACMV_14970
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACMV_14970
   00310 Lysine degradation
    ACMV_14970
   00360 Phenylalanine metabolism
    ACMV_14970
   00380 Tryptophan metabolism
    ACMV_14970
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACMV_14970
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ACMV_14970
   00281 Geraniol degradation
    ACMV_14970
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACMV_14970
   00627 Aminobenzoate degradation
    ACMV_14970
   00930 Caprolactam degradation
    ACMV_14970
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACMV_14970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1681151..1681921
Genome map
AA seq 256 aa AA seqDB search
MPYEMIVTETDGAVAVIRLNRPESLNALCDQLMSELADALRGFDSDKSIRCIVLTGSDRA
FAAGADIKEMQNRSWPETGLDDFIGKSWEVVTTTLKPVIAAVSGYALGGGCELAMMCDII
IAADTAKFGQPEIAIGVIPGAGGTQRLTRAIGKSKAMEMILTGRMMDAEEAERANLVARV
VPAADLMPEAMKLARRIAGMSPVALLQAKRSINAAFETMLAEGVRYERASFLPLFGTPHQ
REGMAAFIEKRKPDFS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgccctacgagatgattgtgaccgaaaccgacggcgccgtggccgtcatccggctgaac
cgcccggagtcgctgaacgcgctgtgcgaccagttgatgagcgaactcgccgacgccttg
cgcggcttcgattccgacaagtcaatccgctgcatcgtgctcaccggatcggacagagcg
ttcgccgccggcgccgacatcaaggaaatgcagaaccgtagctggcccgaaaccggcctc
gacgatttcatcggaaaatcatgggaagtcgttaccacgacgctcaagccggtgatcgcg
gcggtatcgggctatgcgctcggcggcggatgcgagttggcgatgatgtgcgacatcatc
atcgcggccgacacggcgaagttcggccagccggaaatcgccatcggcgtgatccccggt
gccggcggcacccagcgcctgacccgcgccatcgggaaatccaaggcgatggagatgatc
ctgaccggccggatgatggatgccgaagaagccgaacgcgccaacctcgtcgcccgcgtg
gtgccggccgcggacctgatgccggaggcgatgaagctagccaggcgcatcgccggcatg
tctcccgtcgccctcctccaggccaaacgcagcatcaacgccgccttcgagaccatgctg
gccgagggtgtgagatacgagcgggcgagcttccttccgctgttcggcacaccccaccag
cgcgaaggcatggcggccttcatcgagaagcgcaagccggacttttcatag

DBGET integrated database retrieval system