KEGG   Acidiphilium multivorum: ACMV_15770Help
Entry
ACMV_15770        CDS       T01446                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
amv  Acidiphilium multivorum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACMV_15770 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    ACMV_15770 (dapE)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ACMV_15770 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1763830..1764945
Genome map
AA seq 371 aa AA seqDB search
MTEADPVPLARDLLRSRSVTPEDDGAQTVLARALDALGFSIEWLRFGEVSNLVARRGSGS
PHFGFAGHTDVVPPGEGWRHDPFAAVIEDGLLFGRGAVDMKGAIAAFVAALAARPANHAG
TISLLITGDEEGDAVDGTRRILDHLAASGALPEFCLVGEPTCRARLGDTIKIGRRGSISA
HVTVRGVQGHVAYPHLADNPLHRLIPALEALRATTLDEGTAWFEPSSLQITSVDTGNKAG
NVIPASASARLNIRFNDRHTGPDLAAWIRDTVARHAPGAACDIGISGEAFLTEPGPVTTL
FSEAVAAVTGITPKLDTGGGTSDARFIAAHCPVAEFGLVGTSMHRVDEAVPVSELRALAE
IYGRILDRVFR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggccgatcccgttcccctcgcgcgggacctgctgcgcagccgctcggtcacc
cccgaggacgatggcgcccagaccgttctcgcgagggcgctggacgccctgggattctcg
atcgaatggctgcgcttcggcgaggtgagcaacctcgtcgcacgccgcggctcaggcagc
ccgcatttcggctttgccggccataccgacgtcgtgccgccgggcgaggggtggcgccac
gaccccttcgcggccgtcatcgaggacggcctgctgttcggacgcggcgcggtcgacatg
aagggcgccatcgccgccttcgtcgccgccctcgccgcccgcccggcaaatcatgcaggc
acgatctcgctcctcatcaccggcgatgaggaaggcgatgccgtggacggcacccggcgc
attctcgaccatctcgccgcctccggtgccctgccggaattctgcctggtcggcgagccg
acctgccgcgcccggctcggcgacacgatcaagatcggccggcgcggctcgatttcggcg
catgtgacggttcgcggcgtgcaaggccatgtcgcctacccccatctggccgacaatccg
ctccatcgcctgattccggcactcgaagccctgcgcgccacgacgcttgacgagggaacc
gcgtggttcgagccctcatcgctgcagatcaccagcgtcgataccggaaacaaggccggc
aacgtgatcccggcgagcgcctcggcccggctgaacatccgtttcaacgaccgccacacc
ggccccgatctcgccgcctggatccgcgataccgtggcccgccacgcccccggcgccgcc
tgcgacatcggcatcagcggcgaggccttcctgaccgaacccggccccgtgaccacgctg
ttcagcgaggcggtggcggcggtgaccggcatcacgccgaagctcgacaccggcggcggc
acgtcggatgcccgcttcatcgccgcgcactgccccgtcgccgaattcggcctggtcggc
acctcgatgcaccgggtggacgaggccgtgccggtgagcgagctgcgcgcgctggccgaa
atctacggccggatcctggaccgcgtgttccgatga

DBGET integrated database retrieval system