KEGG   Acidiphilium multivorum: ACMV_16670Help
Entry
ACMV_16670        CDS       T01446                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amv  Acidiphilium multivorum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACMV_16670 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACMV_16670 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ACMV_16670 (sucB)
Enzymes [BR:amv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACMV_16670 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1862607..1863839)
Genome map
AA seq 410 aa AA seqDB search
MSTEIKVPTLGESVTTATVARWIRKVGETVAQDEPIVELETDKVTVEVNAPEAGTIEAIA
ADEGAEVEVGALLGTIGAGTGAAAAPKKAEPAAEARPAANPQPGVNPPPPPSGPVARTGH
APMPAAQKMMTEQKIDAAQVDGTGKDGRITKGDVLAFVEKPAAATAPAAPRAPRTADARE
ERVKMTRLRKTIAARLKEAQNTAAMLTTFNEVDMGPVMALRAEYKDVFEKKHKGIRLGFM
SFFVRACIAALREFPAVNAEIDGDEIVYKNFVNMGIAVSSPSGLVVPVLRDADQMNFPQI
EGAIADFGKRARDGALKLDELSGGSFSITNGGVFGSLMSTPIINPPQSAILGMHKIQDRP
MAVGGKVEIRPMMYLALSYDHRIIDGREAVSFLVRVKESIEDPRRLLLDI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaaatcaaggttcccaccctcggcgagagcgtgaccaccgcgaccgtcgcg
cgctggatcaggaaagtgggcgagaccgtcgcccaggacgagccgatcgtcgagctggag
accgacaaggtcaccgtcgaggtcaatgcgcccgaggccggcacgatcgaggcgatcgcc
gccgatgagggggccgaggtcgaggtcggcgccctgctgggcacgatcggcgccggcacc
ggtgccgccgccgcgccgaaaaaggccgagcccgcggcggaggcccgcccggccgccaat
ccgcagcccggcgtcaacccgccgccgccgccctccggcccggtcgcccgcaccggccac
gcgccgatgcccgccgcgcagaagatgatgaccgagcagaagatcgacgccgcccaggtc
gatggcaccggcaaggacggccgcatcaccaagggcgatgtgctggccttcgtcgagaag
ccggccgcagccacagcgccggcagcccccagggcgccgcgcaccgccgatgcccgcgag
gaacgggtgaagatgacccgcctgcgcaagaccatcgccgcaaggctgaaggaagcgcag
aacaccgccgccatgctcaccaccttcaacgaggtggacatgggcccggtgatggcgctc
cgtgccgaatacaaggacgtgttcgagaagaagcacaagggcatccgcctcggcttcatg
agcttcttcgtccgcgcctgcatcgccgccctgcgcgagttcccggcggtcaacgccgag
atcgacggcgacgagatcgtctacaagaacttcgtcaacatgggcatcgccgtctccagc
ccctcgggcctggtggtgccggtgctgcgcgacgccgaccagatgaacttcccgcagatc
gagggggcgatcgccgatttcggcaagcgcgcccgcgacggcgcgctgaagctcgacgag
ctttcgggcggctccttctccatcaccaatggcggcgtgttcggctcgctgatgtcgacc
ccgatcatcaatccgccgcaatcggccattctcggcatgcacaagatccaggaccggccg
atggcggtcggcggcaaggtcgagatccggccgatgatgtatctcgcgctgtcctacgac
caccgcatcatcgacgggcgcgaggcggtctccttcctcgtccgggtgaaggagagcatc
gaggatccgcgccgcctgctgctggacatctga

DBGET integrated database retrieval system