KEGG   Acidiphilium multivorum: ACMV_16700Help
Entry
ACMV_16700        CDS       T01446                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amv  Acidiphilium multivorum
Pathway
amv00020  Citrate cycle (TCA cycle)
amv00640  Propanoate metabolism
amv00660  C5-Branched dibasic acid metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Module
amv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACMV_16700 (sucC)
   00640 Propanoate metabolism
    ACMV_16700 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ACMV_16700 (sucC)
Enzymes [BR:amv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ACMV_16700 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAJ81017
NITE: ACMV_16700
UniProt: F0IZ07
Position
complement(1867787..1868983)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKELLKSYGVAVLDGHVAWTGEEAAEAARKLPGPVYVVKSQIHAGGRGAGHFK
DDPEGKGGVRLAKSPEEVAAAAEAMLGNTLVTKQTGPAGRVVRRVYVEAGCDIKRELYLS
LLVDRAKSEIVIMASTEGGMEIEEVAEKHPEKILRVAVDPASGISGFHARRLGFGLGLDA
TQMKAFAKFVNAMYKAFVALDCAIVEINPLVVTGAGEVVALDAKVSFDDNALYRHPDLEK
LRDEAEEDPKELEAAKHSLNYVALDGSIGCMVNGAGLAMATMDIIKLYGAEPANFLDVGG
GATKERVTAAFKIILSDPNVEGILVNIFGGIMRCDVIAEGVVAAAREVSLSVPLVVRLEG
TNVQLGKDILSKSGLPIIAADNLADAAQKIVAAVKEAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgaataccaggccaaggaactgctgaagtcctatggcgtcgcggtgctg
gacgggcacgtcgcctggaccggcgaggaggccgccgaggcggcgcgcaagctccccggc
ccggtctatgtcgtgaagtcgcagatccatgccggcggccgcggcgccggccatttcaag
gacgatccggagggcaagggcggtgtccgcctcgccaagtcgcccgaggaggtcgccgcc
gccgccgaggcgatgctgggcaacacgctggtgaccaagcagaccggcccggccggccgc
gtcgtccgccgcgtctatgtcgaggccggctgcgacatcaagcgcgagctttacctctcg
ctgctggtcgaccgcgcgaaatccgagatcgtcatcatggcctcgaccgagggcggcatg
gagatcgaggaagtcgccgagaagcatcccgagaagatcctccgcgtcgcggtcgatccg
gcgagcggcatctccggcttccacgcccgccgcctcggcttcggcctcgggctcgacgcc
acccagatgaaggccttcgcgaaattcgtgaacgcgatgtacaaggccttcgtcgcgctc
gactgcgcgatcgtcgagatcaacccgctggtcgtcaccggcgccggcgaggtggtcgcc
ctcgacgccaaggtcagcttcgacgacaacgcgctctaccgtcaccccgatctcgagaag
ctgcgcgacgaggccgaggaagacccgaaggaactcgaggccgccaagcacagcctgaac
tacgtggcgctggacggctcgatcggctgcatggtcaacggcgccggcctcgcgatggcg
acgatggacatcatcaagctctacggcgcggagccggcgaacttcctcgatgtcggcggc
ggggcgaccaaggagcgcgtcaccgcggccttcaagatcatcctgtcggacccgaatgtc
gaaggcatcctggtcaacatcttcggcggcatcatgcgctgcgacgtgatcgccgagggc
gtggtcgccgcggcgcgcgaggtctcgctctcggtgccgctggtcgtccgcctcgagggc
accaacgtgcagctcggcaaggacatcctctccaaatccggcctgcccatcatcgcggcc
gacaatctcgctgacgcggcgcagaagatcgtcgccgccgtgaaggaggccgcataa

DBGET integrated database retrieval system