KEGG   Acidiphilium multivorum: ACMV_17270Help
Entry
ACMV_17270        CDS       T01446                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
amv  Acidiphilium multivorum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:amv00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:amv00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1930194..1931705
Genome map
AA seq 503 aa AA seqDB search
MSATSPLSHDRPNRSWLERLWSSIAEHGRVFVNLPNDDLPSRERAELLADALLGGRGEAS
GAALAAALLGTLRGLAPHERITFCEFLATGFEPDADRLQDAARAYLGSPDAATAAALATA
AEPPRQELLRRMNMAPGGTGALIDMRREVLAELPKRPSLAPLDSDLRHLFASWFNRGFLE
LRRIDWRTPAFILEKLIAYEAVHEIQGWDDLRRRLAPDRRCFAFFHPALPDEPLIFVEVA
LVKGLAEAIGPLLAPAADDDAAEHAQQDAAARANTAIFYSISNCQEGLRGISFGNFLIKQ
VVAELQSELANLRKFSTLSPVPGLRRAIRAVLDSPSAPLLAAEEREAIGRALGTAPAADT
SAEGDANLLKSILEDRPWWTEAPLAAALRGPLLRLAALYLTGAWRANGVPAAARPDPVAR
FHLGNGARLERINWLGNTSPRGIAESFGVMVNYLYDPDAIEARHEAYLRDGTVARAAAVD
QLMAPPGQSWLARRTRGLITTES
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacctcccccctttcgcacgatcgccccaaccgctcctggcttgaacgcctc
tggtcgtcgatcgccgagcacgggcgcgtcttcgtcaatctgccgaatgacgatcttccc
tcgcgcgagcgggcggagcttctggccgatgccctgctgggcgggcgtggcgaagcctcc
ggcgcggccctcgccgctgccctgctcggcacgctgcgcggcctcgcgccgcatgagcgg
atcacgttctgcgaattcctcgccaccggcttcgagccggacgcggaccgcctccaggac
gccgcccgcgcctatctgggatcgcccgacgcggccaccgccgccgccctcgccacagcc
gccgagccgccccgccaggaactcctgcgccggatgaacatggcgcccggcggcaccggc
gcgctgatcgacatgcgccgggaggtgctggccgaactgccgaaacgcccgagccttgct
ccgctcgattccgaccttcggcacctcttcgcatcctggttcaaccgcggcttcctggag
ctccgccggatcgactggcgcaccccggccttcattctcgaaaagctcatcgcctacgag
gcggtgcacgaaatccagggctgggacgacctgcgccgccgcctcgcccccgatcgccgc
tgcttcgccttcttccatcccgccctgccggacgagccgctgatcttcgtcgaggtcgcg
ctggtcaaggggctggccgaggcgatcggcccgctgctggccccggccgccgacgatgat
gccgccgagcatgcccagcaggatgccgcagcacgggcaaatacggcgatcttctattcg
atatcgaactgccaggagggcctgcgcggcatctccttcggcaatttcctgatcaagcag
gtcgttgccgaactccagtccgaactggcaaacctgcggaaattctcgaccctgtccccc
gttcccggcctgcgccgcgccatccgcgcggtgctggactcgccctccgccccgctgctt
gccgccgaggagcgcgaggcgatcggccgcgcgctcggcaccgccccggcggccgatacc
tccgccgaaggcgacgccaatctgctcaaatcgattctcgaggaccgcccatggtggacc
gaagcgccgctcgccgcggcgttgcgcggccccctgctgcgcctcgccgcgctctatctg
accggcgcctggcgcgcgaacggcgttccggccgccgcccggcccgacccggtggcccgc
ttccatctcggcaatggcgcgcgtctcgaacggatcaactggctcggcaacacgagtccg
cgtggcatcgccgagtcgttcggcgtgatggtgaactatctctacgatcccgatgcgatc
gaggcgcggcacgaagcctatctgcgcgacggaacggtggcgcgggccgccgcggtcgac
cagctgatggcgccgccgggccagtcctggctggcccggcgcacgcgcgggctcatcacc
accgaaagctga

DBGET integrated database retrieval system