KEGG   Acidiphilium multivorum: ACMV_18340Help
Entry
ACMV_18340        CDS       T01446                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amv  Acidiphilium multivorum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACMV_18340 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACMV_18340 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACMV_18340 (thrC)
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACMV_18340 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2042998..2044401)
Genome map
AA seq 467 aa AA seqDB search
MRYVSTRGAAPSREFDDVLLAGLAEDGGLFVPETWPVFSPAEWRALRGLPYAELAARVMA
PFMTGGAIGFDDLQAITRASYRGFDHAAVVPLVQLEPSLFVLELFHGPTLAFKDLALQVA
GRLFDHVLSARDERVTIVGATSGDTGSAAIEACRDRLRVDIAILHPEGRTSEVQRRQMTT
VKARNVLNIALSGTFDDCQDLVKAMFADAPFRTELRLSAVNSINWARIAGQIPYFAAAAL
ALGAPDRPVAVAVPTGNFGNILAAWAARQMGLPIERFIVGSNANDILARFLAANDMRTAG
VVETVSPSMDIQVSSNFERLLFEALGRDAPETARTMVDFRASGTMKVSREVWQSVRRDFA
GLALDDAATLAEIARIRAETGYIADPHTAIGIAAARAAAPVGVPVIAAATAHPAKFPEAM
HRAIGIRPGLPPRLDDLYDRQEHFVRAGNSLDEVETLVRHFAHRNDA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtctccacccgcggtgcggccccgtcccgtgaattcgacgatgtcctgctg
gccgggctggccgaggatggcgggctgttcgtgcccgagacctggccggtcttctccccg
gcggaatggcgcgcgctgcgcggcctgccctatgccgagctcgccgcccgcgtcatggcc
ccgttcatgaccggcggcgccatcggcttcgacgatctgcaagccatcacccgcgcctcc
tatcgcgggttcgaccatgcggcggtcgtcccgctggtccagctcgaaccctcgctcttc
gtgctggaactgttccacggcccgaccctcgccttcaaggatctcgccctccaggtcgcc
ggccgcctgttcgaccatgtcctgtccgcccgcgacgagcgggtgacgatcgtgggcgcc
acctcgggcgataccggctccgccgcgatcgaggcctgccgcgaccgcctgcgggtcgac
atcgccatcctccaccccgaaggccgcacctccgaggtccagcgccggcagatgaccacg
gtcaaggcccgcaacgtcctcaacatcgccctctccggcacgttcgacgactgccaggac
ctggtgaaggcgatgttcgccgatgcgcccttccgcaccgagctgcgcctgtcggcggtg
aattcgatcaactgggcgcgcatcgccggccagatcccctatttcgccgccgccgccctc
gccctcggcgcgccggaccgcccggtcgccgtcgcggtgccgaccggcaatttcggcaac
atcctcgccgcctgggcggcgcggcagatgggcctgccgatcgagcgcttcatcgtcggc
agcaacgcgaacgacatcctcgcccgcttcctcgccgccaacgacatgcgcaccgccggc
gtggtcgaaaccgtctccccctcgatggacatccaggtcagctcgaatttcgagcgcctc
ctgttcgaggcgctgggcagggatgcgccggagaccgcccgcaccatggtcgatttccgc
gccagcgggacgatgaaggtctcccgcgaggtctggcagtcggtccggcgggatttcgcc
ggcctcgccctcgacgatgcggcgaccctcgccgaaatcgcccggatccgcgccgaaacc
ggctacatcgccgacccgcacaccgcgatcggcatcgccgccgcccgcgccgccgccccg
gtcggcgtgccggtcatcgccgcggcgacggcgcaccccgccaagttccccgaggcaatg
catcgcgcgatcggcatccgcccggggctgccgccgcgtctcgacgacctatatgaccgt
caggaacatttcgtacgcgcgggcaacagcctcgacgaggtcgagaccctggtccgccat
ttcgcgcacaggaacgatgcatga

DBGET integrated database retrieval system