KEGG   Acidiphilium multivorum: ACMV_18340Help
Entry
ACMV_18340        CDS       T01446                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00260  Glycine, serine and threonine metabolism
amv00750  Vitamin B6 metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01230  Biosynthesis of amino acids
Module
amv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACMV_18340 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACMV_18340 (thrC)
Enzymes [BR:amv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACMV_18340 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAJ81181
NITE: ACMV_18340
UniProt: F0IZH1
Position
complement(2042998..2044401)
Genome map
AA seq 467 aa AA seqDB search
MRYVSTRGAAPSREFDDVLLAGLAEDGGLFVPETWPVFSPAEWRALRGLPYAELAARVMA
PFMTGGAIGFDDLQAITRASYRGFDHAAVVPLVQLEPSLFVLELFHGPTLAFKDLALQVA
GRLFDHVLSARDERVTIVGATSGDTGSAAIEACRDRLRVDIAILHPEGRTSEVQRRQMTT
VKARNVLNIALSGTFDDCQDLVKAMFADAPFRTELRLSAVNSINWARIAGQIPYFAAAAL
ALGAPDRPVAVAVPTGNFGNILAAWAARQMGLPIERFIVGSNANDILARFLAANDMRTAG
VVETVSPSMDIQVSSNFERLLFEALGRDAPETARTMVDFRASGTMKVSREVWQSVRRDFA
GLALDDAATLAEIARIRAETGYIADPHTAIGIAAARAAAPVGVPVIAAATAHPAKFPEAM
HRAIGIRPGLPPRLDDLYDRQEHFVRAGNSLDEVETLVRHFAHRNDA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtctccacccgcggtgcggccccgtcccgtgaattcgacgatgtcctgctg
gccgggctggccgaggatggcgggctgttcgtgcccgagacctggccggtcttctccccg
gcggaatggcgcgcgctgcgcggcctgccctatgccgagctcgccgcccgcgtcatggcc
ccgttcatgaccggcggcgccatcggcttcgacgatctgcaagccatcacccgcgcctcc
tatcgcgggttcgaccatgcggcggtcgtcccgctggtccagctcgaaccctcgctcttc
gtgctggaactgttccacggcccgaccctcgccttcaaggatctcgccctccaggtcgcc
ggccgcctgttcgaccatgtcctgtccgcccgcgacgagcgggtgacgatcgtgggcgcc
acctcgggcgataccggctccgccgcgatcgaggcctgccgcgaccgcctgcgggtcgac
atcgccatcctccaccccgaaggccgcacctccgaggtccagcgccggcagatgaccacg
gtcaaggcccgcaacgtcctcaacatcgccctctccggcacgttcgacgactgccaggac
ctggtgaaggcgatgttcgccgatgcgcccttccgcaccgagctgcgcctgtcggcggtg
aattcgatcaactgggcgcgcatcgccggccagatcccctatttcgccgccgccgccctc
gccctcggcgcgccggaccgcccggtcgccgtcgcggtgccgaccggcaatttcggcaac
atcctcgccgcctgggcggcgcggcagatgggcctgccgatcgagcgcttcatcgtcggc
agcaacgcgaacgacatcctcgcccgcttcctcgccgccaacgacatgcgcaccgccggc
gtggtcgaaaccgtctccccctcgatggacatccaggtcagctcgaatttcgagcgcctc
ctgttcgaggcgctgggcagggatgcgccggagaccgcccgcaccatggtcgatttccgc
gccagcgggacgatgaaggtctcccgcgaggtctggcagtcggtccggcgggatttcgcc
ggcctcgccctcgacgatgcggcgaccctcgccgaaatcgcccggatccgcgccgaaacc
ggctacatcgccgacccgcacaccgcgatcggcatcgccgccgcccgcgccgccgccccg
gtcggcgtgccggtcatcgccgcggcgacggcgcaccccgccaagttccccgaggcaatg
catcgcgcgatcggcatccgcccggggctgccgccgcgtctcgacgacctatatgaccgt
caggaacatttcgtacgcgcgggcaacagcctcgacgaggtcgagaccctggtccgccat
ttcgcgcacaggaacgatgcatga

DBGET integrated database retrieval system