KEGG   Acidiphilium multivorum: ACMV_18550Help
Entry
ACMV_18550        CDS       T01446                                 

Definition
putative asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
amv  Acidiphilium multivorum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACMV_18550
Enzymes [BR:amv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ACMV_18550
Peptidases [BR:amv01002]
 Cysteine Peptidases
  Family C44
   ACMV_18550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2065475..2067319
Genome map
AA seq 614 aa AA seqDB search
MTDAIAHRGPDSEGLALDGQIGLGFRRLAVIDLAGSPQPMHSADGAQTIVFNGEIYNFRQ
LAAELAVLGQSFRTRGDTETILNGWRQWGAGVLDRLDGMFAFALWDRRTRQLLLARDRIG
KKPLYYGTAPDGTLAFGSELAALRPVPGLTDRLDPTAIEDFLALGYIPDPASAFRDIRKL
PPAHAMLIEADRPLPAPFRYWSLPRAHPPADAHEAAGVMGGLFEDAVARRMIADVPLGAF
LSGGIDSGCVVALAARRTDRPLRCFTIGFPEADEREAASEIARHCGAEHETAEMSAHTIL
GDAAAQAAMFGEPFGDHSSVPSRAVAALARRHVTVALSGDGGDEAFGGYRRYRFHHLTDA
ARRMLPGPVRRRVIGTIARAYPKLDAAPRWLRAKSTLTELSLDSAEAYYRSVGRSEAATR
HGLFSAGFRRDIEGHDPATRFHAVAADHEDDDALRVAQRIDLETWLPGDILVKTDRTSMA
VGLEVRCPLLDPTLLAFGLALPADLKLRGGRGKAILRDVAASLLPASVMNRPKQGFAATL
GPDMRKAAPQLREMLCGPQSALLASTWFDGPAVARLLDAHASGRRDHTALLWHLLVLDSF
LADWQHQRRVPHDS
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgcgatcgcgcatcgcggccccgactccgaagggctcgcgctcgacgggcag
atcgggctcggcttccgccggcttgcggtgatcgacctggccggcagcccgcagccgatg
cacagcgccgacggggcgcagaccatcgtgttcaatggggaaatctacaatttccggcag
cttgccgccgaactggcggtattgggtcagagcttccgcacgcggggggacaccgaaacc
atcctcaatggctggcgccaatggggtgcgggggtgctcgaccggctcgatggcatgttc
gccttcgcgctgtgggaccggcggacgcgccagcttctgcttgcccgcgaccggatcggc
aagaagcccctctattacggcacggcgccggacggcacgctggctttcggctcggaactc
gccgcgctcaggccggtgccgggcctgaccgaccggctcgacccgacggcgatcgaggat
tttcttgccctcggctatattcccgacccggcctccgcattccgcgacatccgcaagttg
ccgcccgcccatgcgatgctgatcgaggccgaccggccgctgccggccccgttccgctac
tggagcctgccgcgcgcccatccgccggccgacgcgcatgaggccgccggtgtcatgggc
ggattgttcgaggatgccgtggccaggcgaatgatcgccgatgttccgctcggcgcgttc
ctgtcgggtggcatcgattcgggctgcgtcgtcgcgctcgcggcgcgccggaccgaccgg
ccgctccgctgcttcacgatcggcttccccgaggccgacgaacgggaggccgccagcgag
atcgcccgccactgcggggccgagcacgaaaccgcggagatgtcggctcacaccatcctc
ggcgatgccgcggcccaggccgcgatgttcggcgaaccgttcggcgatcattcctcggtg
ccgagccgcgccgtcgcggccctggcgcggcgtcacgtcaccgtcgccctgtccggcgat
ggcggtgacgaggcattcggcgggtatcggcgataccggttccatcatcttaccgacgcg
gcgcggcgcatgctgcccgggccggtccgacgccgcgtgatcggcacgatcgcccgcgcc
tatccgaagctcgacgccgcgccgcgctggctgcgggcgaaatcgacgcttaccgaactc
agcctcgactccgccgaggcgtattaccgcagcgtcggccgcagcgaggccgcgacgcgc
cacggtttgttcagcgccggcttccgccgcgatatcgagggtcacgaccccgccacgcgc
tttcatgccgtcgccgccgaccatgaggacgacgatgcgctgcgcgtggcccagcggatc
gacctcgaaacctggctgcccggggacatcctggtcaagaccgaccgcacgagcatggcg
gtcggcctcgaggtgcgatgcccgctgctcgacccgacgctgctggctttcggcttggcg
ctgccggcggatctgaagctgcgcggcggccgcggcaaggcgatcctgcgcgatgtggcg
gcgtcgctgctgcccgcctcggtcatgaatcgcccgaaacaggggttcgccgccacgctc
ggcccggacatgcgcaaggcggcgccgcagttgcgggagatgctctgcggcccgcaatcc
gccctcctggccagcacctggttcgatggccccgccgtggcccgcctgctcgatgcccat
gcgagcggccggcgcgaccataccgcgctgctctggcaccttctggtgctcgacagcttc
ctggccgactggcagcaccagcgccgggtgccccatgacagctga

DBGET integrated database retrieval system