KEGG   Acidiphilium multivorum: ACMV_18880Help
Entry
ACMV_18880        CDS       T01446                                 

Gene name
bchD
Definition
magnesium-chelatase 60 kDa subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACMV_18880 (bchD)
Enzymes [BR:amv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ACMV_18880 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2107448..2109148)
Genome map
AA seq 566 aa AA seqDB search
MSPMPPPRPARSAAVVAALFSLDPAGLGGIWVRAPFGPARDGFVEHVRALLPAGAAMRRV
PAGIDDGRLLGGIDLAASLAAGRRVMAAGLLAEAAGGVLVLPMAERLDRALCARLAQAQE
GRFGAIALDEGIGPEEHLAPALADRMAFALDAADLLARRPPARVRGLGAARRRLARMRMD
DGVAEALCHVAAQLGIFSLRPVILAMRAARAAAALAGRRSAGEEDAMLAAQLVLAHRATR
LPAAEEDTDAEPESAPPPACGDEAAEAAPSETEGEQAADRVLDAARSALPPELLAALLLG
QGRRGTAGGRAAAPAAATAAHGRPLGARPGRPGREHGLALVETLRAAAPMQALRRRERPD
HPGRVIVLGGDFRVRRHQAPVRSVAIFAVDASGSSALNRLAEAKGAVQLLLADCYVRRDQ
VALLAFRNRGAELLLPPTAALARARRSLAALPGGGATPLASGIDAARDMALGARRRGNRP
LLVLLTDGGANIGRDRQPGRAAAAADARAAASACAADGIPALVIDTAPRPNAFAAELAGA
MRARYLPLPFADARALSRAIRTEQAA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgatgccgccgccgcgcccggcgcgcagtgcggcggtggtcgcggccctgttc
agcctcgaccccgcggggctgggcggcatctgggttcgcgcgccgttcggcccggcgcgg
gacgggtttgtcgagcatgtccgcgccctgctgccggcgggggcggcgatgcggcgggtg
ccggccgggatcgatgacggacggttgctcggcgggatcgatctcgcggcgagccttgcc
gccgggcgccgggtgatggcggccggcctgctggcggaggcggcgggcggcgtgctggtg
ctgccgatggccgagcggctcgaccgcgccctgtgcgcgcggctggcgcaggcgcaggag
ggccggttcggcgctatcgccctcgatgaggggatcgggccggaggagcatctcgccccc
gcgctggccgaccgcatggccttcgccctcgatgccgccgatctgctggcgcggcgtccg
cctgcgcgggtgcgcgggctcggtgcggcgcggcggcggctggcgcggatgcggatggac
gacggcgtggccgaggcgctctgccatgtggcggcgcagctcggcatcttctcgctgcgg
ccggtgatcctcgccatgcgggcggcgcgggccgccgcggcgctggccggccgccgcagc
gccggcgaggaggacgcgatgctggcagcccagctggtgctcgcccatcgggccacccgc
ttgccggcggcggaagaggacacggacgcggaaccagagtccgcgccgccgccggcgtgc
ggcgacgaggcggcggaggcggcgccatccgagaccgagggcgagcaggcggcggaccgg
gttctcgatgccgcccgcagcgcgctgccaccggaacttctggccgcgctgctgctcggc
cagggccgccgcggcactgccggcgggcgcgccgcagcccctgccgccgcgaccgccgcg
catggaaggccgctcggcgcgcgccccggccggccggggcgggagcatggcctcgccctc
gtcgagacgctgcgggccgccgccccgatgcaggcgctgcgccggcgcgagcggccggat
catccggggcgggtcatcgttctcggcggcgatttcagggttcgccggcatcaggcgccg
gtccgctcggtggcgattttcgcggtcgacgcctccggctcgtcggcgctgaaccggctg
gcggaagcgaagggcgcggtgcagctgctgctggccgattgctatgtgcggcgcgaccag
gtggcgcttctggcgttccgcaaccgcggcgcggagctgctgctgccgcccaccgcggcg
ctggcccgcgcccggcggagccttgcggcactgcccggcggcggggcgacgccgctggcc
agcgggatcgacgccgcgcgggacatggcactcggcgcgcggcggcggggcaaccggccg
ctgctggtgctgctgaccgatggcggggcgaatatcggccgcgaccggcagccgggccgc
gcggcggcagcggcggatgcgcgggcggcggcgtctgcctgtgccgccgacggaattccc
gccctggtgatcgacacggcgccgcggccgaacgctttcgccgccgaactcgccggcgcg
atgcgggcgcgctacctgccactgccctttgccgatgcgcgcgcgctgagccgggcgatc
cgcacggagcaggccgcatga

DBGET integrated database retrieval system