KEGG   Acidiphilium multivorum: ACMV_18980Help
Entry
ACMV_18980        CDS       T01446                                 

Gene name
bchH
Definition
magnesium-chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
amv  Acidiphilium multivorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACMV_18980 (bchH)
Enzymes [BR:amv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ACMV_18980 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2119026..2122583
Genome map
AA seq 1185 aa AA seqDB search
MDSHLSGVIAAARAALAADHPGFVVELHTAERFAADPASLAACVRAIETADIVIATMLFL
DDHIRLVRPHLEARRTNCDAMLCILSAAEIVNLTRLGRLDMSRQKNPALQFLRSLRKRGG
KEVSAAESQLRMLRRLPRLLRLIPGTAQDLRNFFLGMSYWLAGSADNIERLLRLLVARYA
AGPRAALRSQAAIAPPRDYPETGLYHPRLPGRIATDAASLPRLAGSRGTIGLILLRSLVL
SGDVGQYDGVIAAFEAAGFRTLPVFAAGLDARPAIARYLAPDGAPVIDALVSLTGFSLVG
GPAYNDSKSAEAVLAGLDLPYISAHALEFQSIAAWEADPRGLTPIEATMMIALPELDGGI
MPMTYGGRAEGQEDGGDGVRRMSAHPERAAMLAARVARLVDLRRTARAERRIGIVIFNFP
PNSGATGTAAYLSVFESLFNTLAALRAAGYTVDLPADVAALRHAVCVGNAQDHGAAANVA
AKIPRDAHLRAEPHLAAIEAVWGPAPGRHDTDGASLFVLGARFGNVFIGVQPVFGHEGDP
MRLLFEGGFAPTHAFSAFYRWLRQDFGAHALLHFGTHGALEFMPGKHAGLSAACWPDRLI
GEMPNFCLYAANNPSEGMLAKRRANATLISHLTPPVTEAGLYRGLADLKASVFRWRALPP
EAGAEERQGLAALIQAEAARLDLAPADPADPSWADADAAIARLHASLLDVEYALIPVGLH
VVGQAPGAGQRAELLDAAGITDPARRAETDALLAADSELPAIIHALDGGYIRPAPGGDLL
RNPEILPTGRNIYGFDPFRMPGAFAMDDGARQADRLLARHMADCGRLPETVAMLLWGSDN
LKSEGGPIAQALCLVGARPRRDSYGRLAGAELVPLAELGRPRIDVIVTLSGIFRDLLPLQ
TKLLAEALLLAARADEPETQNFVARHARAHIAAHGGTIETAALRVFSNADGTYGANVNQL
VESGTWQTEDELGDAFLRRKGFAYGTDGRPTRCDAVLGGVLKTVDLAYQNLESLDLGVTT
VDHYFDGLGGISRAVRAARGSEAAVYIGDQTTGAGTVRSLAEQVSLETRTRTLNPKYFEA
MLAHGAEGVRHLEAAVTNTLGWSATTGQVDPWIYREIGSVFMLDPEMRRRLAELNPVASV
RIANRLLEAHERHYWSPDEAMLDALRRAGAELEDRLEGLDMEQAA
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atggactcccatctcagcggggtcatcgccgccgcgcgcgccgccctcgccgccgaccat
cccggctttgtcgtcgagctgcacaccgccgagcgcttcgccgccgaccccgcgtccctc
gccgcctgcgtgcgcgcgatcgagacggcggacatcgtgatcgcgaccatgctcttcctc
gacgatcacatccgcctcgtccgcccgcatctcgaagcgaggcggacgaattgcgatgcc
atgctctgcatcctctccgccgccgagatcgtgaacctgaccaggctcggccggctggac
atgagccggcagaagaacccggcgctgcaattcctccgctcgctgcgcaagcgcggcggc
aaggaggtctcggcggccgaatcccagctgcgcatgctccgccggctgccgcgcctgctg
cggctcatccccggcaccgcgcaggacctgcgcaatttcttcctcggcatgtcctactgg
ctcgccggctcggccgacaatatcgagcgcctgctccgcctgctggtcgcgcgctatgcc
gccggcccccgcgccgccctgcgcagccaggccgccatcgccccgccgcgcgactatccc
gaaaccgggctctaccatccgcgccttcccggccgcatcgcgaccgacgcagcgtccctg
ccccgcctcgccggcagccgcggcacgatcgggctgatcctgctgcgcagcctcgtcctg
tccggcgatgtcggccagtatgacggggtgatcgcggcgttcgaggccgccggcttccgt
accctgccggtcttcgccgccgggctcgacgcccgccccgccatcgcgcgctatctcgcg
ccggacggcgcgccggtgatcgacgcgctggtctcgctcaccgggttttccctggtcggc
ggcccggcctacaacgattcgaaatcggcggaggccgtcctcgccgggctcgacctgccc
tacatctccgcccacgcccttgaattccagagcatcgccgcctgggaggccgacccgcgc
ggcctgacgccgatcgaggcgacgatgatgatcgccctccccgagctcgatggcggcatc
atgccgatgacctatggcggccgcgccgagggtcaggaggacggcggcgatggcgtgcgc
cgcatgtcggcacatcccgagcgcgccgccatgctcgccgcccgcgtcgcccgcctggtc
gacctgcgccgcaccgcccgcgccgagcggcgcatcggcatcgtcatcttcaacttcccg
cccaattccggcgccaccggcaccgccgcctatctctccgtcttcgaatccctgttcaac
accctcgccgccctgcgcgccgccggctacacggtcgatctgcccgccgatgtcgccgcg
ctgcgccacgccgtctgtgtcggcaacgcgcaggaccatggcgcggccgccaatgtcgcg
gcgaaaatcccgcgcgatgcgcatctccgcgccgaaccccatctcgccgcgatcgaggcg
gtctggggcccggctcccggccgccacgataccgacggcgcgtcgctgttcgtcctcggc
gcccgcttcggcaacgtcttcatcggcgtccagccggtcttcggccacgaaggcgacccg
atgcgcctgctcttcgagggcggcttcgcgccgacccacgccttcagcgccttctaccgc
tggctgcggcaggatttcggcgcccacgcgctgctccatttcggcacccacggcgcgctg
gaattcatgcccggcaagcatgccggcctgtccgccgcctgctggcccgaccggctgatc
ggcgagatgccgaatttctgcctctacgcggcgaacaacccctccgagggcatgctcgcg
aaacgccgcgccaacgcgacgctgatcagccacctcaccccgccggtcaccgaggccggg
ctctatcgcggcctcgccgatctcaaggcctcggtcttccgctggcgtgccctgccgccc
gaagccggggccgaagagcggcagggcctcgccgccctgatccaggccgaggcggcgcgg
ctcgatctcgcccccgccgacccggccgatccctcctgggccgacgccgatgccgccatc
gcccggctgcacgcctctctgctcgatgtcgaatacgcgctgatcccggtcggcctgcac
gtcgtcggccaggcgcccggcgccggccagcgcgccgaactgctcgatgccgccgggatc
accgatcccgcccgccgcgccgagaccgacgcgctgctcgcggccgacagcgagcttccc
gccatcatccacgcgctcgatggcggctatatccgccccgcgccgggcggcgacctgctg
cgcaaccccgaaatcctgcccaccgggcggaacatctacgggttcgatccattccgcatg
cccggcgccttcgcgatggacgacggcgcccgccaggcggaccgcctgctcgcccgccac
atggccgattgcggccggctgcccgaaaccgtggcgatgctgctctgggggtcggacaac
ctgaaatccgaaggcggcccgatcgcccaggcgctctgcctcgtcggcgcccggccgcgc
cgcgattcctatggccgcctcgccggcgccgagctggtgccgctcgccgagctgggccgg
ccgcggatcgacgtgatcgtcaccctctccggcattttccgcgacctgctgccgctgcaa
acgaagctgctcgccgaagccctgctgctcgccgcccgggcggacgagccggagacgcaa
aacttcgtcgccaggcacgcccgcgcccatatcgccgcccatggcggcacgatcgagacg
gcggcgctgcgcgtcttcagcaatgccgacggcacctatggcgcgaacgtgaaccagctc
gtcgagtccggtacctggcagaccgaggacgagctgggcgatgccttcctccgccgcaag
ggcttcgcctacggcaccgatggccggccgacgcggtgcgacgcggtgctcggcggcgtg
ctcaagaccgtcgatctcgcctaccagaacctcgaatccctcgatctcggcgtcaccacg
gtcgatcactatttcgatggcctcggcggcatcagccgggcggtccgcgccgcccgcggc
agcgaggccgcggtctatatcggcgaccagaccaccggcgccggcaccgtgcgcagcctt
gccgagcaggtctcgctcgaaacccgcacccgcacgctgaacccgaaatatttcgaggcg
atgctcgcccacggcgccgagggcgtgcgccacctcgaagcggcggtgaccaacacgctg
ggatggtcggcgaccaccggccaggtcgacccctggatctaccgcgagatcggcagcgtc
ttcatgctcgaccccgaaatgcgccgccgcctcgccgagctgaacccggtggcctcggtc
cgcatcgccaaccgcctgctcgaagcgcacgagcgccactactggagcccggacgaggcg
atgctcgatgcgctgcgccgcgccggcgccgaactggaagaccgtctcgaaggtctcgac
atggagcaagccgcatga

DBGET integrated database retrieval system